DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5715 and XB5917669

DIOPT Version :9

Sequence 1:NP_651242.1 Gene:CG5715 / 42895 FlyBaseID:FBgn0039180 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_031756322.1 Gene:XB5917669 / 100496293 XenbaseID:XB-GENE-5917670 Length:578 Species:Xenopus tropicalis


Alignment Length:237 Identity:80/237 - (33%)
Similarity:122/237 - (51%) Gaps:23/237 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 YHEGDIL-----------IPLSYRDARFNGTRNGILALSSRWPGG----VVPYEIKGPFTSQELG 124
            :.:||:.           :|....|.....:|:.|.:....|...    .|||.:...:::.|:.
 Frog   119 FGQGDVFSRILKANQGNGVPRVQEDIAVGVSRSAITSTECLWQKTNETVYVPYTLDSKYSNSEVN 183

  Fly   125 NINHAFKEYHTKTCVRFKPRTTEKDYISIGSGKSGCWSSIGRLGGRQEVNLQSPNCLRTYGTPIH 189
            .:..|.:.|.|.|||:|.|.|.|.||::|.|| .||||.:||.||.|.|:::...| .:.||.:|
 Frog   184 TMTSAMEVYATLTCVQFVPYTDEDDYVNITSG-DGCWSYMGRQGGAQVVSVEKGYC-TSEGTTMH 246

  Fly   190 ELMHALGFFHEQNRHERDSYVRVMKDNIKPEMMVNFEKSSSRTQYGFGVEYDYGSVMHYSPTSFT 254
            ||.|||||.||.:|.:||:||.:|...|.|..:||||..::.   .....|||.|:|||...:|:
 Frog   247 ELNHALGFVHEHSRSDRDNYVNIMYQYISPGDIVNFEIMNTN---NLNTIYDYRSIMHYPAWAFS 308

  Fly   255 R-NGQPTLKALRATSDASQMGQRKGFSAGDVRKINAMYKCKV 295
            . .|:.|:.|  ..:....:|.....::.|:.|||.:|:|.|
 Frog   309 NTTGKNTIVA--KLNPNIIIGAGSTMTSLDIIKINRLYECDV 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5715NP_651242.1 Astacin 104..295 CDD:279708 73/195 (37%)
ZnMc_astacin_like 107..291 CDD:239807 70/188 (37%)
XB5917669XP_031756322.1 C2 92..>113 CDD:417471
ZnMc 164..346 CDD:412141 71/188 (38%)
CUB 349..458 CDD:395345 80/237 (34%)
CUB 463..574 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I4140
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9530
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.