DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5715 and syt13

DIOPT Version :9

Sequence 1:NP_651242.1 Gene:CG5715 / 42895 FlyBaseID:FBgn0039180 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_002937348.3 Gene:syt13 / 100496122 XenbaseID:XB-GENE-955112 Length:508 Species:Xenopus tropicalis


Alignment Length:294 Identity:107/294 - (36%)
Similarity:155/294 - (52%) Gaps:34/294 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLLIILGISLGDSMPLEDMDSQEMIDLTDLGDTLFGNPDVETTGALVE-ALGVESPLNPEELGTY 75
            |||.:.|.:|  |.|||.:   :.:|....|:|:..:   :..|..:| .:|....:|.......
 Frog     9 LLLCVSGTAL--SRPLELL---QFLDSPSGGETIVRD---QPEGLPIEDIIGSIEKMNKGRTRLL 65

  Fly    76 HEGDILIPLSYRDARFNGTRNGILALSS--RWPGGV-----VPYEIKGPFTSQELGNINHAFKEY 133
            ..||:.||..         |:.|...|.  .||...     |||.:...:..|:...|..|..|:
 Frog    66 QHGDMAIPTG---------RSAIRCTSKDCYWPKSANGLVNVPYTLAAEYNVQDRATIAAAMLEF 121

  Fly   134 HTKTCVRFKPRTTEKDYISIGSGKSGCWSSIGRL-GGRQEVNLQSPNCLRTYGTPIHELMHALGF 197
            .|.||:||.|.|.|:|:::|.| .|||||.:||. ||.|:::||...|| :.|...|||.|||||
 Frog   122 STLTCIRFVPHTNERDFLNIIS-DSGCWSFLGRAGGGGQDLSLQRGGCL-SNGIIQHELNHALGF 184

  Fly   198 FHEQNRHERDSYVRVMKDNIKPEMMVNFEKSSSRTQYGFGVEYDYGSVMHYSPTSFTRNGQ-PTL 261
            .||..|.:|||||::..:||:||...:|.|:.:..|   |:||||||||||...|::.:.| ||:
 Frog   185 VHEHTRSDRDSYVKIFWNNIQPEYKDSFNKTDTDNQ---GMEYDYGSVMHYGRNSYSIDYQLPTI 246

  Fly   262 KALRATSDASQMGQRKGFSAGDVRKINAMYKCKV 295
            :.:  .:....:|||.|.|:.|..|||.:|.|.:
 Frog   247 QPI--PNGLIPIGQRYGLSSLDAAKINRLYNCSI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5715NP_651242.1 Astacin 104..295 CDD:279708 84/197 (43%)
ZnMc_astacin_like 107..291 CDD:239807 80/190 (42%)
syt13XP_002937348.3 ZnMc_hatching_enzyme 93..276 CDD:239810 81/189 (43%)
CUB 294..388 CDD:238001
CUB 391..504 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.