DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5715 and astl2d.5

DIOPT Version :9

Sequence 1:NP_651242.1 Gene:CG5715 / 42895 FlyBaseID:FBgn0039180 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_031756347.1 Gene:astl2d.5 / 100495579 XenbaseID:XB-GENE-22069752 Length:497 Species:Xenopus tropicalis


Alignment Length:219 Identity:82/219 - (37%)
Similarity:117/219 - (53%) Gaps:12/219 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 IPLSYRDARFNGTRNGILALSSRWP---GGV-VPYEIKGPFTSQELGNINHAFKEYHTKTCVRFK 142
            :|....|.....:|:.|......|.   |.| |||.:...:::.|:..:..|.:.|.|.|||:|.
 Frog    56 VPRVQEDIAVGVSRSAITYTECLWQKTNGTVYVPYTLDDKYSNSEVNTMTSAMEVYATLTCVQFV 120

  Fly   143 PRTTEKDYISIGSGKSGCWSSIGRLGGRQEVNLQSPNCLRTYGTPIHELMHALGFFHEQNRHERD 207
            |.|.|.||::|.|| .||||.:||..|.|.|:::...| .:.||.:|||.|||||.|||:|.:||
 Frog   121 PYTDEDDYVNITSG-DGCWSYMGRQRGAQVVSVEKGYC-TSEGTTMHELNHALGFVHEQSRSDRD 183

  Fly   208 SYVRVMKDNIKPEMMVNFEKSSSRTQYGFGVEYDYGSVMHYSPTSFTR-NGQPTLKALRATSDAS 271
            :||.:|...|.|..:..|:|..|.   ..|..|||.|||||...:|:. .||.|:.|  ..:...
 Frog   184 NYVNIMYQYISPGDVAEFKKMESN---NLGTTYDYRSVMHYPAWAFSNTTGQNTIVA--KPNPNI 243

  Fly   272 QMGQRKGFSAGDVRKINAMYKCKV 295
            .:|.....::.|:.|||.:|:|.|
 Frog   244 IIGAGNTMTSLDIIKINRLYECDV 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5715NP_651242.1 Astacin 104..295 CDD:279708 77/195 (39%)
ZnMc_astacin_like 107..291 CDD:239807 74/185 (40%)
astl2d.5XP_031756347.1 ZnMc 83..265 CDD:412141 75/188 (40%)
CUB 268..377 CDD:395345 82/219 (37%)
CUB 382..493 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.