DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5715 and astl2f

DIOPT Version :9

Sequence 1:NP_651242.1 Gene:CG5715 / 42895 FlyBaseID:FBgn0039180 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_002934133.3 Gene:astl2f / 100495416 XenbaseID:XB-GENE-22069764 Length:624 Species:Xenopus tropicalis


Alignment Length:286 Identity:100/286 - (34%)
Similarity:135/286 - (47%) Gaps:46/286 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ILGISLGDSMPLEDMDSQEMIDLTDLGDTLFGNPDVETTGALVEALGVESPLNPEELGTYHEGDI 80
            ::.:||.:... ||..|   ..|..|...|..|.|  |...||                  :|||
 Frog   147 LMSLSLQEGQK-EDNSS---ASLDTLSQILEANKD--TNVPLV------------------QGDI 187

  Fly    81 LIPLSYRDARFNGTRNGILALSSRWPGGV-----VPYEIKGPFTSQELGNINHAFKEYHTKTCVR 140
            |..|.      ..|.|   ..|..||...     |||.|...|...|...|..|..|..|.:|:|
 Frog   188 LEKLG------RSTTN---CTSCLWPRATSGLVNVPYTIASVFDDSEQELIQGALNELMTLSCIR 243

  Fly   141 FKPRTTEKDYISIGSGKSGCWSSIGRLGGRQEVNLQSPNCLRTYGTPIHELMHALGFFHEQNRHE 205
            ||.||.|.|::|..|| :|||||:|:.||.|||::....|: ::|...||.:|||||.||..|.:
 Frog   244 FKARTIETDFLSFQSG-NGCWSSVGKTGGSQEVSVSKSGCM-SHGIIQHETLHALGFIHEHCRSD 306

  Fly   206 RDSYVRVMKDNIKPEMMVNFEKSSSRTQYGFGVEYDYGSVMHYSPTSFTRN-GQPTLKALRATSD 269
            ||:||.::...|......:|.|.:|.   ..|::|||.|||||...:||.. ||.|:  :.....
 Frog   307 RDNYVDIIYKYISEGDRSSFTKVNSN---NLGLQYDYSSVMHYGRFTFTNTPGQATI--IPKPDL 366

  Fly   270 ASQMGQRKGFSAGDVRKINAMYKCKV 295
            :..:|||.|.|:.||.|:|.:|.|.:
 Frog   367 SVPIGQRYGVSSLDVAKLNKLYNCNI 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5715NP_651242.1 Astacin 104..295 CDD:279708 79/196 (40%)
ZnMc_astacin_like 107..291 CDD:239807 75/189 (40%)
astl2fXP_002934133.3 ZnMc 209..390 CDD:412141 76/187 (41%)
CUB 394..504 CDD:238001
CUB 507..621 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I4140
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9530
Panther 1 1.100 - - O PTHR10127
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.150

Return to query results.
Submit another query.