DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5715 and astl2a

DIOPT Version :9

Sequence 1:NP_651242.1 Gene:CG5715 / 42895 FlyBaseID:FBgn0039180 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_002934118.2 Gene:astl2a / 100492493 XenbaseID:XB-GENE-5966804 Length:492 Species:Xenopus tropicalis


Alignment Length:293 Identity:107/293 - (36%)
Similarity:154/293 - (52%) Gaps:39/293 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GSLLLLIILGISLGDSMPL-EDMDSQEMIDLTDL-GDTLFGNPDVETTGALVEALGVESPLNPEE 71
            |:.:.::||...||.::|. ..:.|...|:.|:: |:.:|.  .:..|             |...
 Frog     2 GTHIRVVILSQLLGLALPSPTQILSNSTINATNMNGNDIFS--QILRT-------------NQGH 51

  Fly    72 LGTYHEGDILIPLSYRDARFNGTRNGILALSSRWP----GGV-VPYEIKGPFTSQELGNINHAFK 131
            .|.:::|||    ..|..|.:||....|     ||    |.| |||.|...:...::.:|..|..
 Frog    52 GGLHYQGDI----DVRVERSDGTCKDCL-----WPKSQNGSVLVPYRISADYGVSDIESITDAML 107

  Fly   132 EYHTKTCVRFKPRTTEKDYISIGSGKSGCWSSIGRLGGRQEVNLQSPNCLRTYGTPIHELMHALG 196
            |:.|.|||||.||:.|:|::.|.| ::||:||.|||||.|.|:|..|:|:. :|...|||.|.||
 Frog   108 EFSTLTCVRFVPRSAERDHVIIRS-ENGCFSSKGRLGGAQTVSLLKPDCVE-FGIIQHELNHVLG 170

  Fly   197 FFHEQNRHERDSYVRVMKDNIKPEMMVNFEKSSSRTQYGFGVEYDYGSVMHYSPTSFTR-NGQPT 260
            ..||.:|.:||.|:.|::.||..|...:|||..|..   .|:||||.|||||...:|:. .|..|
 Frog   171 LAHENSRMDRDEYITVIETNIPAEFHRDFEKPESDI---VGMEYDYNSVMHYGSGAFSNTGGMST 232

  Fly   261 LKALRATSDASQMGQRKGFSAGDVRKINAMYKC 293
            |...|  :..:|:||..|.|..||.|||.:|:|
 Frog   233 LVPKR--NPNAQLGQLYGLSNLDVSKINRLYEC 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5715NP_651242.1 Astacin 104..295 CDD:279708 85/196 (43%)
ZnMc_astacin_like 107..291 CDD:239807 81/185 (44%)
astl2aXP_002934118.2 ZnMc 81..263 CDD:412141 82/188 (44%)
CUB 267..377 CDD:238001
CUB 380..491 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 166 1.000 Domainoid score I3822
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I4140
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9530
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.