DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5715 and astl2g

DIOPT Version :9

Sequence 1:NP_651242.1 Gene:CG5715 / 42895 FlyBaseID:FBgn0039180 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_002934115.1 Gene:astl2g / 100491886 XenbaseID:XB-GENE-22069768 Length:505 Species:Xenopus tropicalis


Alignment Length:225 Identity:90/225 - (40%)
Similarity:127/225 - (56%) Gaps:23/225 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 HEGDILIPLSYRDARFNG------TRNGILALSSRWPGGVVPYEIKGPFTSQELGNINHAFKEYH 134
            ||.||::.:.....:.:|      |.:||:.         |||.|...|::.|:..|..|.:::.
 Frog    62 HESDIVVSVDRNAMKCDGDTCRWKTSDGIVR---------VPYTISANFSATEVSVIVDAMQDFA 117

  Fly   135 TKTCVRFKPRTTEKDYISIGSGKSGCWSSIGRLGGRQEVNLQSPNCLRTYGTPIHELMHALGFFH 199
            |.|||.|.|||.|.||:.| ...|||||.:|:.||.|||:|....|:.. ||..|||.|||||:|
 Frog   118 TLTCVNFVPRTVEPDYLQI-IPDSGCWSYVGKTGGAQEVSLNQGGCVGK-GTVQHELNHALGFYH 180

  Fly   200 EQNRHERDSYVRVMKDNIKPEMMVNFEKSSSRTQYGFGVEYDYGSVMHYSPTSFTRNGQPTLKAL 264
            ||:|.:||:||.::..||.|..:.||:|.::.   ..|.||||.|||||...:|.:  ||.|..:
 Frog   181 EQSRSDRDNYVNILTGNIIPASIGNFDKYNTN---NLGQEYDYSSVMHYGRNAFAK--QPGLDTI 240

  Fly   265 RATSDAS-QMGQRKGFSAGDVRKINAMYKC 293
            ....:.: .:|||.|.|..|:.|||.:|:|
 Frog   241 VPKPNPNVPIGQRYGLSNLDISKINQLYQC 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5715NP_651242.1 Astacin 104..295 CDD:279708 82/191 (43%)
ZnMc_astacin_like 107..291 CDD:239807 80/184 (43%)
astl2gXP_002934115.1 Astacin 83..272 CDD:279708 85/204 (42%)
ZnMc_hatching_enzyme 88..270 CDD:239810 83/197 (42%)
CUB 270..384 CDD:238001 1/1 (100%)
CUB 387..497 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I4140
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9530
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.