DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5715 and astl3b.4

DIOPT Version :9

Sequence 1:NP_651242.1 Gene:CG5715 / 42895 FlyBaseID:FBgn0039180 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_031746772.1 Gene:astl3b.4 / 100491283 XenbaseID:XB-GENE-22069691 Length:533 Species:Xenopus tropicalis


Alignment Length:319 Identity:112/319 - (35%)
Similarity:153/319 - (47%) Gaps:62/319 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LIILGISLGDS--------MPLE---DMDSQEMIDLTD-LG-----DTL---------------F 46
            :|:|...:|.:        .|.:   |.||...:||.. ||     |.|               .
 Frog     9 IILLACIMGSAWTYPAQIIFPYQEKLDKDSLTNLDLLKALGKSAEKDALATEGTVREMPVLGKKS 73

  Fly    47 GNPDVETTGALVEALGVESPLNPEELGTYHEGDILIPLSYRDARFNGTRNGILALSSRWPGG--- 108
            |:.||.|..:.|.. |:..|       || |||||.|..         |:.:......||..   
 Frog    74 GSVDVFTQISKVNR-GISVP-------TY-EGDILRPEG---------RSAMNCTECLWPKSTDG 120

  Fly   109 --VVPYEIKGPFTSQELGNINHAFKEYHTKTCVRFKPRTTEKDYISIGSGKSGCWSSIGRLGGRQ 171
              :|||.....:::.:|.....|.:||.:.|||||.||..|..:::|.|| |||.|.:|:|||.|
 Frog   121 TVIVPYNFSSNYSADQLALFKSAMQEYESLTCVRFVPRANETAFLNIISG-SGCVSFLGKLGGAQ 184

  Fly   172 EVNLQSPNCLRTYGTPIHELMHALGFFHEQNRHERDSYVRVMKDNIKPEMMVNFEKSSSRTQYGF 236
            .|.|.|..|:.. |...|||.|||||:|||:|.:||.||.:..:||.|....||.|:::.   ..
 Frog   185 TVQLASYGCIYR-GIIQHELNHALGFYHEQSRSDRDDYVTIHTENILPGYEGNFNKANTN---NL 245

  Fly   237 GVEYDYGSVMHYSPTSFTRNGQPTLKALRATSDASQMGQRKGFSAGDVRKINAMYKCKV 295
            |:||||.|||||...:|::||..|:  :........:|||.|.|..||.|||.:|:|.|
 Frog   246 GLEYDYSSVMHYPGDAFSKNGNLTI--VPKPDPTVPIGQRDGLSILDVSKINRLYQCDV 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5715NP_651242.1 Astacin 104..295 CDD:279708 82/195 (42%)
ZnMc_astacin_like 107..291 CDD:239807 78/188 (41%)
astl3b.4XP_031746772.1 ZnMc_hatching_enzyme 119..300 CDD:239810 79/187 (42%)
CUB 304..412 CDD:238001
CUB 417..525 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.