DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5715 and LOC100488711

DIOPT Version :9

Sequence 1:NP_651242.1 Gene:CG5715 / 42895 FlyBaseID:FBgn0039180 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_031756326.1 Gene:LOC100488711 / 100488711 -ID:- Length:497 Species:Xenopus tropicalis


Alignment Length:268 Identity:88/268 - (32%)
Similarity:132/268 - (49%) Gaps:31/268 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LFGNPDVETTGALVEALGVESPLNPE-ELGTYHEGDIL-----------IPLSYRDARFNGTRNG 97
            |||.       ||.:.....||.|.. :...:.:||:.           :|....|.....:|:.
 Frog    13 LFGQ-------ALSKYQATLSPNNSTGKSDPFGQGDVFSRILKANQGNGVPRVQEDIAVGVSRSA 70

  Fly    98 ILALSSRWPGG----VVPYEIKGPFTSQELGNINHAFKEYHTKTCVRFKPRTTEKDYISIGSGKS 158
            |.:....|...    .|||.:...:::.|:..:..|.:.|.|.|||:|.|.|.|.||::|.|| .
 Frog    71 ITSTECLWQKTNETVYVPYTLDSKYSNSEVNTMTSAMEVYATLTCVQFVPYTDEDDYVNITSG-D 134

  Fly   159 GCWSSIGRLGGRQEVNLQSPNCLRTYGTPIHELMHALGFFHEQNRHERDSYVRVMKDNIKPEMMV 223
            ||||.:||.||.|.|:::...| .:.||.:|||.|||||.||.:|.:||:||.:|...|.|..:|
 Frog   135 GCWSYMGRQGGAQVVSVEKGYC-TSEGTTMHELNHALGFVHEHSRSDRDNYVNIMYQYISPGDIV 198

  Fly   224 NFEKSSSRTQYGFGVEYDYGSVMHYSPTSFTR-NGQPTLKALRATSDASQMGQRKGFSAGDVRKI 287
            |||..::.   .....|||.|:|||...:|:. .|:.|:.|  ..:....:|.....::.|:.||
 Frog   199 NFEIMNTN---NLNTIYDYRSIMHYPAWAFSNTTGKNTIVA--KLNPNIIIGAGSTMTSLDIIKI 258

  Fly   288 NAMYKCKV 295
            |.:|:|.|
 Frog   259 NRLYECDV 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5715NP_651242.1 Astacin 104..295 CDD:279708 73/195 (37%)
ZnMc_astacin_like 107..291 CDD:239807 70/188 (37%)
LOC100488711XP_031756326.1 ZnMc 82..264 CDD:412141 71/188 (38%)
CUB 276..373 CDD:214483
CUB 378..489 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.