DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5715 and mep1ba

DIOPT Version :9

Sequence 1:NP_651242.1 Gene:CG5715 / 42895 FlyBaseID:FBgn0039180 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001070089.2 Gene:mep1ba / 100151009 ZFINID:ZDB-GENE-041014-209 Length:677 Species:Danio rerio


Alignment Length:218 Identity:89/218 - (40%)
Similarity:119/218 - (54%) Gaps:13/218 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 EGDILIPLSYRDARFNGTRNGILALSSRWPGGVVPYEIKGPFTSQELGNINHAFKEYHTKTCVRF 141
            ||||||       ....:||.||....||| ..|||.:.........|.|..||::|..|||:.|
Zfish    53 EGDILI-------EEGESRNTILGEQYRWP-TTVPYFLDNSLEINAKGVILKAFEQYRLKTCIDF 109

  Fly   142 KPRTTEKDYISIGSGKSGCWSSIG-RLGGRQEVNLQSPNCLRTYGTPIHELMHALGFFHEQNRHE 205
            ||...|.:||.:..| |||:|.:| |..|:||:::.| || .:.||..||.:||||.:|||:|.:
Zfish   110 KPWNGESNYIFVFKG-SGCYSKVGNRQMGKQELSIGS-NC-DSLGTVEHEFLHALGLWHEQSRSD 171

  Fly   206 RDSYVRVMKDNIKPEMMVNFEKSSSRTQYGFGVEYDYGSVMHYSPTSFTRNGQPTLKALRATSDA 270
            ||.||.::.|.|:.....||...........||.|||.||||||.|||.:..:||: ..:.....
Zfish   172 RDDYVIIVWDQIQDGKEHNFNLYDETQSSSLGVPYDYSSVMHYSKTSFNKGSEPTI-VTKIPEFL 235

  Fly   271 SQMGQRKGFSAGDVRKINAMYKC 293
            :.:|||..||..|:.|:|.:|.|
Zfish   236 NVIGQRMEFSDNDLLKLNRLYNC 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5715NP_651242.1 Astacin 104..295 CDD:279708 79/191 (41%)
ZnMc_astacin_like 107..291 CDD:239807 74/184 (40%)
mep1baNP_001070089.2 ZnMc_meprin 29..258 CDD:239809 88/216 (41%)
Astacin 72..260 CDD:279708 79/192 (41%)
MAM 268..432 CDD:279023
MAM 268..430 CDD:99706
MATH_Meprin_Beta 430..599 CDD:239751
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm25214
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2664
SonicParanoid 1 1.000 - - X245
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.