DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uck and NRK1

DIOPT Version :9

Sequence 1:NP_001138105.1 Gene:Uck / 42894 FlyBaseID:FBgn0263398 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_014270.1 Gene:NRK1 / 855594 SGDID:S000005073 Length:240 Species:Saccharomyces cerevisiae


Alignment Length:247 Identity:50/247 - (20%)
Similarity:102/247 - (41%) Gaps:64/247 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KSPFLIGVAGGTASGKSTVCKKIMEQLGQAEMDHTQRQVVSISQDSFYR--ELTPAEKAKAQKGL 87
            |...|:.::|.::|||:|:.|.......:|.:.|         :|.||:  ...|.:   |:..:
Yeast     4 KKVILVALSGCSSSGKTTIAKLTASLFTKATLIH---------EDDFYKHDNEVPVD---AKYNI 56

  Fly    88 FNFDHPDAFNEELMYSTLQ----------NILKGHKVEIPSYDYRTNSLDFENVLVIYPA----- 137
            .|:|.|:|.:.:|....|.          .::..:.|:.|...:..:...::.:...|.:     
Yeast    57 QNWDSPEALDFKLFGKELDVIKQTGKIATKLIHNNNVDDPFTKFHIDRQVWDELKAKYDSINDDK 121

  Fly   138 -DVVLFEGILVFYFPKIRELFHMKLFVDTDSDTRLARRVPRDINERG-RDLDAVLTQYMTFVKPA 200
             :||:.:|.::|....|.:.|.:|:.|....:....||..|    :| :.||:.      :|.|.
Yeast   122 YEVVIVDGFMIFNNTGISKKFDLKILVRAPYEVLKKRRASR----KGYQTLDSF------WVDPP 176

  Fly   201 --FEEF------CSPTKKFAD-----VIIPRGADNTVAIDLIVQHIRDFLNN 239
              |:||      .:..:.|.:     ::.||.:.|          |::|:|:
Yeast   177 YYFDEFVYESYRANHAQLFVNGDVEGLLDPRKSKN----------IKEFIND 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UckNP_001138105.1 UMPK 29..235 CDD:238981 47/237 (20%)
NRK1NP_014270.1 NRK1 8..198 CDD:238982 43/211 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.