DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Uck and ATCAY

DIOPT Version :9

Sequence 1:	NP_001138105.1	Gene:	Uck / 42894	FlyBaseID:	FBgn0263398	Length:	305	Species:	Drosophila melanogaster
Sequence 2:	NP_149053.1	Gene:	ATCAY / 85300	HGNCID:	779	Length:	371	Species:	Homo sapiens

Alignment Length:	143	Identity:	27/143 - (18%)
Similarity:	39/143 - (27%)	Gaps:	63/143 - (44%)

- Green bases have known domain annotations that are detailed below.

  Fly     9 TLRLPNGD-----------------------GAAANDEVKSPFLIGVAGGTASGKSTVCKKIMEQ 50
            |||:.|.|                       |:...|....|..:...|.....|:.|..:|...
Human     7 TLRMENVDVKEEWQDEDLPRPLPEETGVELLGSPVEDTSSPPNTLNFNGAHRKRKTLVAPEINIS 71

  Fly    51 LGQAEMDHTQRQVVSISQDSFYRELTPAEKAKAQKGLFNFDHPDAFNEELMYSTLQNILKGHKVE 115
            |.|:|        .|:..|.|                  .|.||..:           :....:|
Human    72 LDQSE--------GSLLSDDF------------------LDTPDDLD-----------INVDDIE 99

  Fly   116 IPSYDYRTNSLDF 128
            .|.   .|:||:|
Human   100 TPD---ETDSLEF 109

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Uck	NP_001138105.1	UMPK	29..235	CDD:238981	19/100 (19%)
ATCAY	NP_149053.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..54		8/46 (17%)
		BNIP2	59..187	CDD:315215	18/91 (20%)
		Required for interaction with KLC1. /evidence=ECO:0000250	115..120
		CRAL_TRIO_2	189..314	CDD:316255
		Mediates interaction with GLS. /evidence=ECO:0000269\|PubMed:16899818	190..371
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	331..371
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0572
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900