DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uck and DAS2

DIOPT Version :9

Sequence 1:NP_001138105.1 Gene:Uck / 42894 FlyBaseID:FBgn0263398 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_010303.3 Gene:DAS2 / 851583 SGDID:S000002427 Length:232 Species:Saccharomyces cerevisiae


Alignment Length:244 Identity:61/244 - (25%)
Similarity:105/244 - (43%) Gaps:75/244 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LIGVAGGTASGKSTVCKKIMEQLGQAEMDHTQRQVVSISQDSFYRELTPAEKAKAQKGLFNFDHP 93
            :|.:.||.|:|           :|...:|         .|::|             |.|:|..:.
Yeast    12 VISIGGGHATG-----------VGAIALD---------LQNTF-------------KSLYNSINI 43

  Fly    94 DAFNEELMYSTLQNILKGHKVEIPSYDYRTNSLDFENVL-VIY------------------PADV 139
            ...|       |.|:::|:   |.||:  .|..||:|:| ::|                  |.|:
Yeast    44 RVIN-------LDNMIEGN---IKSYN--NNDYDFDNILNLVYEKHAVTSQNDMIQHDYEDPIDL 96

  Fly   140 VLFEGILVFYFPKIRELFHMKLFVDTDSDTRLARRVPRDINERGRDLDAVLTQYMTFVKPAFEEF 204
            ::..|....|..:|.|:..:|:|:|:|:|.||...:.:........|..::|:||..::|..:::
Yeast    97 IIVCGCYALYDKRINEISQLKVFLDSDADKRLISLIKKKNVGSNEQLAQLITEYMDHLRPEMQQY 161

  Fly   205 CSPTKKFADVIIPRGADN---TVAIDLIVQHIRDF--------LNNRSR 242
            ..||:.|||:|||...:|   .|.:|.||:.|.|.        .||:.|
Yeast   162 IEPTRTFADLIIPSTNENLGRAVLVDGIVKAIEDTKSQIEGNNTNNKIR 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UckNP_001138105.1 UMPK 29..235 CDD:238981 57/227 (25%)
DAS2NP_010303.3 Udk 8..209 CDD:223645 60/241 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I1704
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10285
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.920

Return to query results.
Submit another query.