DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uck and UKL3

DIOPT Version :9

Sequence 1:NP_001138105.1 Gene:Uck / 42894 FlyBaseID:FBgn0263398 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001323275.1 Gene:UKL3 / 842031 AraportID:AT1G55810 Length:488 Species:Arabidopsis thaliana


Alignment Length:251 Identity:122/251 - (48%)
Similarity:164/251 - (65%) Gaps:29/251 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DGAAAN--------DEVKSPFLIGVAGGTASGKSTVCKKIMEQLGQAEMDHTQRQVVSISQDSFY 72
            ||.|:|        :|...||:||||||.||||:|||..||:||      |.||.|| ::|||||
plant    25 DGLASNRPEQMAEEEEHGQPFVIGVAGGAASGKTTVCDMIMQQL------HDQRAVV-VNQDSFY 82

  Fly    73 RELTPAEKAKAQKGLFNFDHPDAFNEELMYSTLQNILKGHKVEIPSYDYRTNSLDFENVLV---I 134
            ..:...|..:...  :||||||||:.|.:.|:::.:.||..|:||:||:::..   .||..   :
plant    83 HNVNEVELVRVHD--YNFDHPDAFDTEQLLSSMEKLRKGQAVDIPNYDFKSYK---NNVFPPRRV 142

  Fly   135 YPADVVLFEGILVFYFPKIRELFHMKLFVDTDSDTRLARRVPRDINERGRDLDAVLTQYMTFVKP 199
            .|:||::.||||:|:.|::|:|.:||:|||.|:|.|||||:.||..|:|||:..||.||..||||
plant   143 NPSDVIILEGILIFHDPRVRDLMNMKIFVDADADVRLARRIKRDTVEKGRDIATVLDQYSKFVKP 207

  Fly   200 AFEEFCSPTKKFADVIIPRGADNTVAIDLIVQHIRDFLNNRSRHGSTGNMALYMNL 255
            |||:|..||||:||:|||||.||.||||||||||      .::.|......:|.||
plant   208 AFEDFILPTKKYADIIIPRGGDNHVAIDLIVQHI------HTKLGQHDLCKIYPNL 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UckNP_001138105.1 UMPK 29..235 CDD:238981 111/208 (53%)
UKL3NP_001323275.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 201 1.000 Domainoid score I867
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D929897at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100147
Panther 1 1.100 - - O PTHR10285
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.