DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uck and AT1G03030

DIOPT Version :9

Sequence 1:NP_001138105.1 Gene:Uck / 42894 FlyBaseID:FBgn0263398 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_171802.2 Gene:AT1G03030 / 839473 AraportID:AT1G03030 Length:301 Species:Arabidopsis thaliana


Alignment Length:172 Identity:43/172 - (25%)
Similarity:80/172 - (46%) Gaps:26/172 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LIGVAGGTASGKSTVCKKIMEQLGQ----------AEMDHTQRQVVSISQDSF--YRELTPA--- 78
            |:|:||...:|||||..:::.::.:          ||::.....:| :..|.|  ||....|   
plant    97 LVGLAGPPGAGKSTVANEVVRRVNKLWPQKAASFDAEVNPPDVAIV-LPMDGFHLYRSQLDAMED 160

  Fly    79 -EKAKAQKGLFNFDHPDAFNEELMYSTLQNILKGHKVEIPSYDYRTNSLDFENVLVIYPADVVLF 142
             ::|.|::|.     |..|:..|:.:.|:.:.....|.:||:|:.......:::.|.....||:.
plant   161 PKEAHARRGA-----PWTFDPALLLNCLKKLKNEGSVYVPSFDHGVGDPVEDDIFVSLQHKVVIV 220

  Fly   143 EGILVFY----FPKIRELFHMKLFVDTDSDTRLARRVPRDIN 180
            ||..:..    :..|.::|..|.|:|.:.||.:.|...|.|:
plant   221 EGNYILLEEGSWKDISDMFDEKWFIDVNLDTAMQRVENRHIS 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UckNP_001138105.1 UMPK 29..235 CDD:238981 43/172 (25%)
AT1G03030NP_171802.2 NK 71..297 CDD:418433 43/172 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.