DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uck and UK/UPRT1

DIOPT Version :9

Sequence 1:NP_001138105.1 Gene:Uck / 42894 FlyBaseID:FBgn0263398 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_198903.1 Gene:UK/UPRT1 / 834088 AraportID:AT5G40870 Length:486 Species:Arabidopsis thaliana


Alignment Length:233 Identity:114/233 - (48%)
Similarity:158/233 - (67%) Gaps:12/233 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQDLRNADTLRLPNGDGAAANDEVKSPFLIGVAGGTASGKSTVCKKIMEQLGQAEMDHTQRQVVS 65
            :..||:|.:...|:.....|   .|.||:|||:|||||||:|||..|::||    .||   :||.
plant    39 VSSLRSAVSSSSPSSSDPEA---PKQPFIIGVSGGTASGKTTVCDMIIQQL----HDH---RVVL 93

  Fly    66 ISQDSFYRELTPAEKAKAQKGLFNFDHPDAFNEELMYSTLQNILKGHKVEIPSYDYRTNSLDFEN 130
            ::||||||.||..|..:.|:  :||||||||:.|.:....:.:..|...::|.||::|:....:.
plant    94 VNQDSFYRGLTSEELQRVQE--YNFDHPDAFDTEQLLHCAETLKSGQPYQVPIYDFKTHQRRSDT 156

  Fly   131 VLVIYPADVVLFEGILVFYFPKIRELFHMKLFVDTDSDTRLARRVPRDINERGRDLDAVLTQYMT 195
            ...:..:||::.||||||:..::|.|.:||:|||||:|.|||||:.||..|||||:::||.||..
plant   157 FRQVNASDVIILEGILVFHDSRVRNLMNMKIFVDTDADVRLARRIRRDTVERGRDVNSVLEQYAK 221

  Fly   196 FVKPAFEEFCSPTKKFADVIIPRGADNTVAIDLIVQHI 233
            ||||||::|..|:||:||||||||.||.||:|||.|||
plant   222 FVKPAFDDFVLPSKKYADVIIPRGGDNHVAVDLITQHI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UckNP_001138105.1 UMPK 29..235 CDD:238981 106/205 (52%)
UK/UPRT1NP_198903.1 UMPK 64..262 CDD:238981 106/205 (52%)
UPRTase 280..481 CDD:405383
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 201 1.000 Domainoid score I867
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D929897at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100147
Panther 1 1.100 - - LDO PTHR10285
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.