DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uck and UKL4

DIOPT Version :9

Sequence 1:NP_001138105.1 Gene:Uck / 42894 FlyBaseID:FBgn0263398 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001320072.1 Gene:UKL4 / 828757 AraportID:AT4G26510 Length:469 Species:Arabidopsis thaliana


Alignment Length:217 Identity:117/217 - (53%)
Similarity:153/217 - (70%) Gaps:13/217 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 AAANDEVKSPFLIGVAGGTASGKSTVCKKIMEQLGQAEMDHTQRQVVSISQDSFYRELTPAEKAK 82
            :|:.|..:.||:||||||.||||:|||..|::||      |.|| ||.|:.||||..||..|.|:
plant    40 SASEDIQRQPFVIGVAGGAASGKTTVCDMIIQQL------HDQR-VVLINLDSFYHNLTEEELAR 97

  Fly    83 AQKGLFNFDHPDAFNEELMYSTLQNILKGHKVEIPSYDYRT-NSLDFENVLVIYPADVVLFEGIL 146
            ..:  :||||||||:.|.:.|.::.:.:|..|:||.||::| .|..|..|   .|.||::.||||
plant    98 VHE--YNFDHPDAFDTEHLLSCMEKLRQGQAVDIPKYDFKTYRSSVFRRV---NPTDVIILEGIL 157

  Fly   147 VFYFPKIRELFHMKLFVDTDSDTRLARRVPRDINERGRDLDAVLTQYMTFVKPAFEEFCSPTKKF 211
            :|:.|::|:|.:||:||.||:|.|||||:.||..|.|||:..||.||..||||||::|..||||:
plant   158 LFHDPRVRKLMNMKIFVCTDADVRLARRIKRDTVENGRDIGTVLDQYSKFVKPAFDDFILPTKKY 222

  Fly   212 ADVIIPRGADNTVAIDLIVQHI 233
            ||:|||||.||.||||||||||
plant   223 ADIIIPRGGDNHVAIDLIVQHI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UckNP_001138105.1 UMPK 29..235 CDD:238981 113/206 (55%)
UKL4NP_001320072.1 UMPK 51..244 CDD:238981 111/204 (54%)
UPRTase 265..466 CDD:405383
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 201 1.000 Domainoid score I867
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D929897at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100147
Panther 1 1.100 - - O PTHR10285
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.