powered by:
Protein Alignment Uck and UPP
DIOPT Version :9
Sequence 1: | NP_001138105.1 |
Gene: | Uck / 42894 |
FlyBaseID: | FBgn0263398 |
Length: | 305 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_190958.1 |
Gene: | UPP / 824557 |
AraportID: | AT3G53900 |
Length: | 296 |
Species: | Arabidopsis thaliana |
Alignment Length: | 39 |
Identity: | 14/39 - (35%) |
Similarity: | 20/39 - (51%) |
Gaps: | 1/39 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 181 ERGRD-LDAVLTQYMTFVKPAFEEFCSPTKKFADVIIPR 218
|..|: |..|:.:.|:.:.||..||..|.:..|.|.|.|
plant 120 EASREWLPTVVGEIMSPMGPASVEFIDPREPIAVVPILR 158
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0572 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_100147 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.710 |
|
Return to query results.
Submit another query.