DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uck and UKL5

DIOPT Version :9

Sequence 1:NP_001138105.1 Gene:Uck / 42894 FlyBaseID:FBgn0263398 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_189380.1 Gene:UKL5 / 822365 AraportID:AT3G27440 Length:465 Species:Arabidopsis thaliana


Alignment Length:282 Identity:129/282 - (45%)
Similarity:171/282 - (60%) Gaps:45/282 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RLPNG--DGAAANDEV--------KSPFLIGVAGGTASGKSTVCKKIMEQLGQAEMDHTQRQVVS 65
            :|.||  |....:|.|        |.||:|||||||||||:|||..||.||      |.|| ||.
plant     3 KLSNGVRDHCLISDYVSPSAPAPLKQPFVIGVAGGTASGKTTVCNMIMSQL------HDQR-VVL 60

  Fly    66 ISQDSFYRELTPAEKAKAQKGLFNFDHPDAFNEELMYSTLQNILKGHKVEIPSYDYRTNSLDFEN 130
            ::|||||..||..:..|..:  :|||||||||.|::.|.::.:..|..|.|||||::.:. ..|:
plant    61 VNQDSFYHSLTKEKLNKVHE--YNFDHPDAFNTEVLLSCMEKLRSGQPVNIPSYDFKIHQ-SIES 122

  Fly   131 VLVIYPADVVLFEGILVFYFPKIRELFHMKLFVDTDSDTRLARRVPRDINERGRDLDAVLTQYMT 195
            ...:.|.||::.|||||...|::|:|.:||:|||||:|.||:||:.||..||||::..||.||..
plant   123 SSPVNPGDVIILEGILVLNDPRVRDLMNMKIFVDTDADVRLSRRIQRDTVERGRNIQNVLEQYTK 187

  Fly   196 FVKPAFEEFCSPTKKFADVIIPRGADNTVAIDLIVQHIRDFLNNRSRHGSTGNMA-LYMNL---- 255
            ||||:|:|:..|:.|:||:|||||.||.|||||||||||..|   .:|    |:. :|.|:    
plant   188 FVKPSFDEYIQPSMKYADIIIPRGGDNDVAIDLIVQHIRTKL---CQH----NLCKIYSNIFIIS 245

  Fly   256 -------------DLNATGAGF 264
                         |:|.|...|
plant   246 STFQIKGMHTLIRDINTTKHDF 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UckNP_001138105.1 UMPK 29..235 CDD:238981 110/205 (54%)
UKL5NP_189380.1 UMPK 31..228 CDD:238981 111/206 (54%)
UPRTase 246..447 CDD:405383 4/22 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 201 1.000 Domainoid score I867
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D929897at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100147
Panther 1 1.100 - - O PTHR10285
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.