DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uck and UKL2

DIOPT Version :9

Sequence 1:NP_001138105.1 Gene:Uck / 42894 FlyBaseID:FBgn0263398 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_189355.1 Gene:UKL2 / 822338 AraportID:AT3G27190 Length:483 Species:Arabidopsis thaliana


Alignment Length:287 Identity:125/287 - (43%)
Similarity:175/287 - (60%) Gaps:31/287 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RLPNGDGAAANDEV--KSPFLIGVAGGTASGKSTVCKKIMEQLGQAEMDHTQRQVVSISQDSFYR 73
            ||.|...:|.:|..  ..||:|||.|||||||:|||..|::||    .||   ::|.::||||||
plant    44 RLSNSSFSATDDPAAPHQPFVIGVTGGTASGKTTVCDMIIQQL----HDH---RIVLVNQDSFYR 101

  Fly    74 ELTPAEKAKAQKGLFNFDHPDAFNEELMYSTLQNILKGHKVEIPSYDYRTNSLDFENVLVIYPAD 138
            .||..|....|:  :||||||||:.|.:...:..:..|...:||.||::|:....:....:...|
plant   102 GLTSEELEHVQE--YNFDHPDAFDTEQLLHCVDILKSGQPYQIPIYDFKTHQRKVDAFRQVNACD 164

  Fly   139 VVLFEGILVFYFPKIRELFHMKLFVDTDSDTRLARRVPRDINERGRDLDAVLTQYMTFVKPAFEE 203
            |::.||||||:..::|:|.:||:|||||:|.|||||:.||..|||||:|:||.||..||||||::
plant   165 VIILEGILVFHDSRVRDLMNMKIFVDTDADVRLARRIRRDTVERGRDVDSVLEQYAKFVKPAFDD 229

  Fly   204 FCSPTKKFADVIIPRGADNTVAIDLIVQHIRDFLNNRSRHGSTGNMALYMNLDLNATGAGFAGPD 268
            |..|:||:||||||||.||.||:|||||||      .::.|......:|.|:.:..|        
plant   230 FVLPSKKYADVIIPRGGDNHVAVDLIVQHI------HTKLGQHDLCKIYPNVFVIET-------- 280

  Fly   269 GSNLGTYNAIRRFSTICKELNMQGNYF 295
                 |:. ||...|:.:|.::..:.|
plant   281 -----TFQ-IRGMHTLIREKDISKHDF 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UckNP_001138105.1 UMPK 29..235 CDD:238981 108/205 (53%)
UKL2NP_189355.1 UMPK 64..262 CDD:238981 108/212 (51%)
UPRTase 281..481 CDD:405383 6/22 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D929897at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100147
Panther 1 1.100 - - O PTHR10285
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.