DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Uck and Jup

DIOPT Version :9

Sequence 1:	NP_001138105.1	Gene:	Uck / 42894	FlyBaseID:	FBgn0263398	Length:	305	Species:	Drosophila melanogaster
Sequence 2:	NP_112309.2	Gene:	Jup / 81679	RGDID:	620412	Length:	745	Species:	Rattus norvegicus

Alignment Length:	106	Identity:	21/106 - (19%)
Similarity:	44/106 - (41%)	Gaps:	17/106 - (16%)

- Green bases have known domain annotations that are detailed below.

  Fly    40 KSTVCKKIMEQLGQAEMDHTQRQVVSISQDSFYRELTPAEKAKAQKGLFNFDHPDAFNE------ 98
            ::.|..::::.|.:|..| .||.|.:.:|..:...:...|..:...|..:....|..|.
  Rat   520 EAAVIPRLVQLLVKAHQD-AQRHVAAGTQQPYTDGVRMEEIVEGCTGALHILARDPMNRMEIFRL 583

  Fly    99 -------ELMYSTLQNILK---GHKVEIPSYDYRTNSLDFE 129
                   :|:||:::||.:   |...|:.......:::|.|
  Rat   584 NTIPLFVQLLYSSVENIQRVAAGVLCELAQDKEAADAIDAE 624

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Uck	NP_001138105.1	UMPK	29..235	CDD:238981	21/106 (20%)
Jup	NP_112309.2	Interaction with DSC1 and DSG1. /evidence=ECO:0000250	132..297
		armadillo repeat	144..169	CDD:293788
		armadillo repeat	186..212	CDD:293788
		armadillo repeat	221..253	CDD:293788
		Arm	221..253	CDD:395413
		armadillo repeat	261..297	CDD:293788
		ARM 5	298..341
		armadillo repeat	305..338	CDD:293788
		PLN03200	<328..>658	CDD:215629	21/106 (20%)
		ARM	341..381	CDD:214547
		ARM 6	342..381
		armadillo repeat	345..380	CDD:293788
		ARM 7	383..420
		armadillo repeat	393..418	CDD:293788
		ARM 8	423..464
		armadillo repeat	426..464	CDD:293788
		ARM 9	470..510
		armadillo repeat	470..508	CDD:293788
		ARM 10	512..551		8/31 (26%)
		armadillo repeat	515..572	CDD:293788	10/52 (19%)
		Interaction with DSC1. /evidence=ECO:0000250	574..661		10/51 (20%)
		armadillo repeat	577..611	CDD:293788	6/33 (18%)
		armadillo repeat	618..652	CDD:293788	2/7 (29%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0572
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900