DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uck and Jup

DIOPT Version :10

Sequence 1:NP_001138105.1 Gene:Uck / 42894 FlyBaseID:FBgn0263398 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_112309.2 Gene:Jup / 81679 RGDID:620412 Length:745 Species:Rattus norvegicus


Alignment Length:106 Identity:21/106 - (19%)
Similarity:44/106 - (41%) Gaps:17/106 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 KSTVCKKIMEQLGQAEMDHTQRQVVSISQDSFYRELTPAEKAKAQKGLFNFDHPDAFNE------ 98
            ::.|..::::.|.:|..| .||.|.:.:|..:...:...|..:...|..:....|..|.      
  Rat   520 EAAVIPRLVQLLVKAHQD-AQRHVAAGTQQPYTDGVRMEEIVEGCTGALHILARDPMNRMEIFRL 583

  Fly    99 -------ELMYSTLQNILK---GHKVEIPSYDYRTNSLDFE 129
                   :|:||:::||.:   |...|:.......:::|.|
  Rat   584 NTIPLFVQLLYSSVENIQRVAAGVLCELAQDKEAADAIDAE 624

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UckNP_001138105.1 UMPK 29..235 CDD:238981 21/106 (20%)
JupNP_112309.2 CTNNAbd_CTNNB1-like 73..142 CDD:459249
Adaptin_N <120..>289 CDD:396262
Interaction with DSC1 and DSG1. /evidence=ECO:0000250 132..297
armadillo repeat 144..169 CDD:293788
armadillo repeat 186..212 CDD:293788
armadillo repeat 221..253 CDD:293788
Arm 221..253 CDD:425727
armadillo repeat 261..297 CDD:293788
ARM 5 298..341
armadillo repeat 305..338 CDD:293788
PLN03200 <328..>658 CDD:215629 21/106 (20%)
ARM 341..381 CDD:214547
ARM 6 342..381
armadillo repeat 345..380 CDD:293788
ARM 7 383..420
armadillo repeat 393..418 CDD:293788
ARM 8 423..464
armadillo repeat 426..464 CDD:293788
ARM 9 470..510
armadillo repeat 470..508 CDD:293788
ARM 10 512..551 8/31 (26%)
armadillo repeat 515..572 CDD:293788 10/52 (19%)
Interaction with DSC1. /evidence=ECO:0000250 574..661 10/51 (20%)
armadillo repeat 577..611 CDD:293788 6/33 (18%)
armadillo repeat 618..652 CDD:293788 2/7 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.