DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uck and UCK2

DIOPT Version :9

Sequence 1:NP_001138105.1 Gene:Uck / 42894 FlyBaseID:FBgn0263398 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_036606.2 Gene:UCK2 / 7371 HGNCID:12562 Length:261 Species:Homo sapiens


Alignment Length:237 Identity:152/237 - (64%)
Similarity:186/237 - (78%) Gaps:13/237 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 QDLRNADTLRLPNGDGAAANDEVKSPFLIGVAGGTASGKSTVCKKIMEQLGQAEMDHTQRQVVSI 66
            |.|:|.   :.|||.         .||||||:||||||||:||.||::.|||.|:|:.|:|||.:
Human     7 QTLQNH---QQPNGG---------EPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVIL 59

  Fly    67 SQDSFYRELTPAEKAKAQKGLFNFDHPDAFNEELMYSTLQNILKGHKVEIPSYDYRTNSLDFENV 131
            |||||||.||..:||||.||.|||||||||:.||:..||:.|.:|..|:||.||:.::|.. |..
Human    60 SQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRK-EET 123

  Fly   132 LVIYPADVVLFEGILVFYFPKIRELFHMKLFVDTDSDTRLARRVPRDINERGRDLDAVLTQYMTF 196
            :.:||||||||||||.||..::|:||.||||||||:||||:|||.|||:||||||:.:|:||:||
Human   124 VTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITF 188

  Fly   197 VKPAFEEFCSPTKKFADVIIPRGADNTVAIDLIVQHIRDFLN 238
            |||||||||.||||:|||||||||||.|||:||||||:|.||
Human   189 VKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILN 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UckNP_001138105.1 UMPK 29..235 CDD:238981 141/205 (69%)
UCK2NP_036606.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24 9/28 (32%)
UMPK 22..228 CDD:238981 141/206 (68%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 236..261
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145816
Domainoid 1 1.000 269 1.000 Domainoid score I1858
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40850
Inparanoid 1 1.050 291 1.000 Inparanoid score I2801
Isobase 1 0.950 - 0 Normalized mean entropy S1209
OMA 1 1.010 - - QHG61683
OrthoDB 1 1.010 - - D509086at33208
OrthoFinder 1 1.000 - - FOG0002695
OrthoInspector 1 1.000 - - otm41030
orthoMCL 1 0.900 - - OOG6_100147
Panther 1 1.100 - - O PTHR10285
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1606
SonicParanoid 1 1.000 - - X2455
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.