DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uck and Nmrk2

DIOPT Version :9

Sequence 1:NP_001138105.1 Gene:Uck / 42894 FlyBaseID:FBgn0263398 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_081396.1 Gene:Nmrk2 / 69564 MGIID:1916814 Length:195 Species:Mus musculus


Alignment Length:157 Identity:35/157 - (22%)
Similarity:66/157 - (42%) Gaps:34/157 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LIGVAGGTASGKSTVCKKIMEQLGQAEMDHTQRQVVSISQDSFYRELTPAEK-AKAQKGLFNFDH 92
            :||:.|.|..||:|:...:::.|....:.|         ||.|::   |.:: |..:.|...:|.
Mouse     4 IIGIGGVTNGGKTTLTNSLLKALPNCCVIH---------QDDFFK---PQDQIAVGEDGFKQWDV 56

  Fly    93 PDAFNEELMYSTLQ-------NILKGHKVEIPSYDYRTNSLDFENVLVIYPADVVLFEGILVFYF 150
            .::.:.|.|.||:|       ...:.|.|.:.|....|:              |:|.||.|::.:
Mouse    57 LESLDMETMLSTVQAWVKDPHKFARAHGVSLQSGASDTH--------------VLLLEGFLLYSY 107

  Fly   151 PKIRELFHMKLFVDTDSDTRLARRVPR 177
            ..:.:|:..:.|:....:....||..|
Mouse   108 RPLVDLYSQRYFLTVPYEECKRRRRSR 134

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
UckNP_001138105.1 UMPK 29..235 CDD:238981 35/157 (22%)
Nmrk2NP_081396.1 NRK1 4..164 CDD:238982 35/157 (22%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:Q9NWW6 35..38 1/2 (50%)