DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uck and Uckl1

DIOPT Version :9

Sequence 1:NP_001138105.1 Gene:Uck / 42894 FlyBaseID:FBgn0263398 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001365934.1 Gene:Uckl1 / 68556 MGIID:1915806 Length:549 Species:Mus musculus


Alignment Length:218 Identity:106/218 - (48%)
Similarity:149/218 - (68%) Gaps:12/218 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KSPFLIGVAGGTASGKSTVCKKIMEQLGQAEMDHTQRQVVSISQDSFYRELTPAEKAKAQKGLFN 89
            |..|.||:.||:||||:||.:.|:|.|...       .||.:|.||||:.||..::.:|....||
Mouse    96 KEAFAIGLGGGSASGKTTVARMIIEALDVP-------WVVLLSMDSFYKVLTQQQQEQAACNNFN 153

  Fly    90 FDHPDAFNEELMYSTLQNILKGHKVEIPSYDYRTNS--LDFENVLVIYPADVVLFEGILVFYFPK 152
            |||||||:.:|:.|||:.:.:|..|::|.||:.|:|  .|::   .:|.|:|::||||:.|....
Mouse   154 FDHPDAFDFDLIISTLKKLKQGRSVQVPIYDFTTHSRKKDWK---TLYGANVIIFEGIMAFADKT 215

  Fly   153 IRELFHMKLFVDTDSDTRLARRVPRDINERGRDLDAVLTQYMTFVKPAFEEFCSPTKKFADVIIP 217
            :.||..||:|||||||.||.||:.|||:|||||::.|:.||..||||||:::..||.:.||:::|
Mouse   216 LLELLDMKIFVDTDSDIRLVRRLRRDISERGRDIEGVIKQYNKFVKPAFDQYIQPTMRLADIVVP 280

  Fly   218 RGADNTVAIDLIVQHIRDFLNNR 240
            ||:.|||||||||||:...|..|
Mouse   281 RGSGNTVAIDLIVQHVHSQLEER 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UckNP_001138105.1 UMPK 29..235 CDD:238981 102/207 (49%)
Uckl1NP_001365934.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..74
UMPK 101..299 CDD:238981 102/207 (49%)
UPRTase 330..533 CDD:405383
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D509086at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100147
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1606
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.