Sequence 1: | NP_001138105.1 | Gene: | Uck / 42894 | FlyBaseID: | FBgn0263398 | Length: | 305 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_024307683.1 | Gene: | UCKL1 / 54963 | HGNCID: | 15938 | Length: | 612 | Species: | Homo sapiens |
Alignment Length: | 372 | Identity: | 124/372 - (33%) |
---|---|---|---|
Similarity: | 182/372 - (48%) | Gaps: | 107/372 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 25 KSPFLIGVAGGTASGKSTVCKKIMEQLGQAEMDHTQRQVVSISQDSFYR--------ELTPAEKA 81
Fly 82 KAQKGLFNFDHPDAFNEELMYSTLQNILKGHKVEIPSYDYRTNS--LDFENVLVIYPADVVLFEG 144
Fly 145 ILVFYFPKIRELFHMKLFVDTDSDTRLARRVPRDINERGRDLDAVLTQYMTFVKPAFEEFCSPTK 209
Fly 210 KFADVIIPRGADNTVAIDLIVQHIRDFL----------------------------NNRSRHGST 246
Fly 247 GNMALYMNLDLNAT-----------------------GAG-----FAGPDGSNLGT--------- 274
Fly 275 --------------YNAIRRFST-------ICKELNMQGNYFFETNK 300 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Uck | NP_001138105.1 | UMPK | 29..235 | CDD:238981 | 101/215 (47%) |
UCKL1 | XP_024307683.1 | UMPK | 101..307 | CDD:238981 | 101/215 (47%) |
UPRTase | <417..596 | CDD:317125 | 7/41 (17%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0572 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D509086at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 1 | 0.900 | - | - | OOG6_100147 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R1606 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.750 |