powered by:
Protein Alignment Uck and nmrk1
DIOPT Version :9
Sequence 1: | NP_001138105.1 |
Gene: | Uck / 42894 |
FlyBaseID: | FBgn0263398 |
Length: | 305 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_017209594.1 |
Gene: | nmrk1 / 541321 |
ZFINID: | ZDB-GENE-050320-8 |
Length: | 213 |
Species: | Danio rerio |
Alignment Length: | 45 |
Identity: | 11/45 - (24%) |
Similarity: | 24/45 - (53%) |
Gaps: | 7/45 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 92 HPDAFNEELMYSTLQN----ILKGHKVEIPS-YDYRTNSLDFENV 131
|.| .:|::|..:|: |...|:..:.: :|.:|.::|..|:
Zfish 57 HKD--KQEVLYYFIQSNKLTIKPTHEGRVEAKFDGKTLTVDILNL 99
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Uck | NP_001138105.1 |
UMPK |
29..235 |
CDD:238981 |
11/45 (24%) |
nmrk1 | XP_017209594.1 |
V-set |
34..131 |
CDD:311561 |
11/45 (24%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0572 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.