DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uck and nmrk1

DIOPT Version :9

Sequence 1:NP_001138105.1 Gene:Uck / 42894 FlyBaseID:FBgn0263398 Length:305 Species:Drosophila melanogaster
Sequence 2:XP_017209594.1 Gene:nmrk1 / 541321 ZFINID:ZDB-GENE-050320-8 Length:213 Species:Danio rerio


Alignment Length:45 Identity:11/45 - (24%)
Similarity:24/45 - (53%) Gaps:7/45 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 HPDAFNEELMYSTLQN----ILKGHKVEIPS-YDYRTNSLDFENV 131
            |.|  .:|::|..:|:    |...|:..:.: :|.:|.::|..|:
Zfish    57 HKD--KQEVLYYFIQSNKLTIKPTHEGRVEAKFDGKTLTVDILNL 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UckNP_001138105.1 UMPK 29..235 CDD:238981 11/45 (24%)
nmrk1XP_017209594.1 V-set 34..131 CDD:311561 11/45 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.