DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uck and Uckl1

DIOPT Version :9

Sequence 1:NP_001138105.1 Gene:Uck / 42894 FlyBaseID:FBgn0263398 Length:305 Species:Drosophila melanogaster
Sequence 2:XP_038961641.1 Gene:Uckl1 / 499956 RGDID:1565465 Length:549 Species:Rattus norvegicus


Alignment Length:218 Identity:107/218 - (49%)
Similarity:149/218 - (68%) Gaps:12/218 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KSPFLIGVAGGTASGKSTVCKKIMEQLGQAEMDHTQRQVVSISQDSFYRELTPAEKAKAQKGLFN 89
            |..|.||:.||:||||:||.:.|:|.|...       .||.:|.||||:.||..::.:|....||
  Rat    96 KEAFAIGLGGGSASGKTTVARMIIEALDVP-------WVVLLSMDSFYKVLTQQQQEQAACNNFN 153

  Fly    90 FDHPDAFNEELMYSTLQNILKGHKVEIPSYDYRTNS--LDFENVLVIYPADVVLFEGILVFYFPK 152
            |||||||:.:|:.|||:.:.:|..|:||.||:.|:|  .|::   .:|.|:|::||||:.|....
  Rat   154 FDHPDAFDFDLIISTLKKLKQGRSVQIPIYDFTTHSRKKDWK---TLYGANVIIFEGIMAFADKT 215

  Fly   153 IRELFHMKLFVDTDSDTRLARRVPRDINERGRDLDAVLTQYMTFVKPAFEEFCSPTKKFADVIIP 217
            :.||..||:|||||||.||.||:.|||:|||||::.|:.||..||||||:::..||.:.||:::|
  Rat   216 LLELLDMKIFVDTDSDIRLVRRLRRDISERGRDIEGVIKQYNKFVKPAFDQYIQPTMRLADIVVP 280

  Fly   218 RGADNTVAIDLIVQHIRDFLNNR 240
            ||:.|||||||||||:...|..|
  Rat   281 RGSGNTVAIDLIVQHVHSQLEER 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UckNP_001138105.1 UMPK 29..235 CDD:238981 103/207 (50%)
Uckl1XP_038961641.1 UMPK 101..299 CDD:238981 103/207 (50%)
UPRTase 330..533 CDD:405383
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D509086at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100147
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.