DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uck and kri

DIOPT Version :9

Sequence 1:NP_001138105.1 Gene:Uck / 42894 FlyBaseID:FBgn0263398 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001261451.1 Gene:kri / 38655 FlyBaseID:FBgn0035639 Length:261 Species:Drosophila melanogaster


Alignment Length:307 Identity:62/307 - (20%)
Similarity:94/307 - (30%) Gaps:124/307 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GQAEMDHTQRQVVSISQDSFYRELTPAEKAKAQKGLFNFDHPDAFNEELM--YSTLQNILK--GH 112
            |.:..||.|.|..:..|:......|.|..|.          |.|.:||::  |.:...:|:  ..
  Fly    16 GSSSSDHQQPQQEAQEQEQQLHTPTHAHAAV----------PAATSEEILAEYGSNLKLLECNSQ 70

  Fly   113 KVEIPSY--DYRTNSLDFE---------------NVLVIYPADV-----VLFEGILVFYFPKIR- 154
            ..|:.:.  |..|...||:               |.|.....||     .::||:      |.| 
  Fly    71 VAELLTILRDKNTTRSDFKFYADRLIRLVIEESLNQLPYTHCDVETPTGAIYEGL------KYRS 129

  Fly   155 -----------ELFHM------------KLFVDTDSDTRLAR----RVPRDINERGRDLDAVLTQ 192
                       |....            |:.|::|::|..||    |.|.||..|     .||..
  Fly   130 GNCGVSIIRSGEAMEQGLRDCCRSIRIGKILVESDANTHEARVVYARFPDDIGSR-----QVLLM 189

  Fly   193 YMTFVKPAFEEFCSPTKKFADVIIPRGADNTV--AIDLIVQHIRDFLNNRSRHGSTGNMALYMNL 255
            |                    .|:..|  |||  |::::           ..||...:..:..||
  Fly   190 Y--------------------PIMSTG--NTVLQAVNVL-----------REHGVPESCIILSNL 221

  Fly   256 DLNATGAGFAGPDGSNLGTYNAIRRFSTICKEL-----NMQGNYFFE 297
                    |..|..:.. ..||..:...:..||     |..|..:|:
  Fly   222 --------FCTPIAART-VVNAFPKLKILTSELHPVAPNHFGQKYFD 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UckNP_001138105.1 UMPK 29..235 CDD:238981 49/238 (21%)
kriNP_001261451.1 UPRTase 70..245 CDD:291353 42/227 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446866
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D929897at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100147
Panther 1 1.100 - - P PTHR10285
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1606
SonicParanoid 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.