DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uck and CG11593

DIOPT Version :9

Sequence 1:NP_001138105.1 Gene:Uck / 42894 FlyBaseID:FBgn0263398 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001261392.1 Gene:CG11593 / 38477 FlyBaseID:FBgn0035488 Length:484 Species:Drosophila melanogaster


Alignment Length:226 Identity:48/226 - (21%)
Similarity:80/226 - (35%) Gaps:73/226 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 TVCKKIMEQLGQAEMDHTQRQV----VSISQDSFYR-ELTPAEKAK-----AQKGLFNFDHP--- 93
            |..:|.:.:|.||:.||.:.::    .|...:...| ||.|.|...     .::.|.| .||   
  Fly    39 TAPEKNILKLEQAKQDHDKEELEFKTTSALDNRILRPELLPMEAMPQRHNIIERTLAN-SHPLMS 102

  Fly    94 ----DAFNEELMYSTLQNILKGHKVEIPSYDYRTNSLDFENVLVIYPADVVLFEGILVFYFPKIR 154
                |:.:|...       ||..:.::|    |:|          :| |||          |...
  Fly   103 PTNTDSDSEPFQ-------LKKQEKQLP----RSN----------FP-DVV----------PTTE 135

  Fly   155 ELFHMKLFVDTDSDTRLARRVPRD-----INERGRDL-----DAVLTQYMTFVKPAFEEFC---- 205
            .       |...::....|..|:|     :.....|:     ||.::||:..|:..|:...    
  Fly   136 T-------VQVKNNLNQCRNKPQDAKVSLLRANSPDILSSESDADVSQYLAAVESNFQSVSLMPN 193

  Fly   206 -SPTKKFADVIIPRGADNTVAIDLIVQHIRD 235
             :..|......:|.|.|.: ::|.|..|..|
  Fly   194 GNGKKSKRSTALPGGEDIS-SLDSISNHSFD 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UckNP_001138105.1 UMPK 29..235 CDD:238981 47/224 (21%)
CG11593NP_001261392.1 BNIP2 <293..342 CDD:289278
CRAL_TRIO_2 345..475 CDD:290435
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.