DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uck and JUP

DIOPT Version :9

Sequence 1:NP_001138105.1 Gene:Uck / 42894 FlyBaseID:FBgn0263398 Length:305 Species:Drosophila melanogaster
Sequence 2:XP_016880077.1 Gene:JUP / 3728 HGNCID:6207 Length:762 Species:Homo sapiens


Alignment Length:199 Identity:36/199 - (18%)
Similarity:66/199 - (33%) Gaps:69/199 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 KSTVCKKIMEQLGQAEMDHTQRQVVSISQDSFYRELTPAEKAKAQKGLFNFDHPDAFNE------ 98
            ::.|..::::.|.:|..| .||.|.:.:|..:...:...|..:...|..:....|..|.      
Human   537 EAAVIPRLVQLLVKAHQD-AQRHVAAGTQQPYTDGVRMEEIVEGCTGALHILARDPMNRMEIFRL 600

  Fly    99 -------ELMYSTLQNILK---GHKVEIPSYDYRTNSLDFENVLVIYPADVVLFEGILVFYFPKI 153
                   :|:||:::||.:   |...|:.......:::|.|....                  .:
Human   601 NTIPLFVQLLYSSVENIQRVAAGVLCELAQDKEAADAIDAEGASA------------------PL 647

  Fly   154 RELFHMK-----------LF-VDTDSDTRLARRVPRD---------------------INE-RGR 184
            .||.|.:           || :..|.:....:||..:                     ||| .|.
Human   648 MELLHSRNEGTATYAAAVLFRISEDKNPDYRKRVSVELTNSLFKHDPAAWEAAQSMIPINEPYGD 712

  Fly   185 DLDA 188
            |:||
Human   713 DMDA 716

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UckNP_001138105.1 UMPK 29..235 CDD:238981 36/199 (18%)
JUPXP_016880077.1 armadillo repeat 161..186 CDD:293788
armadillo repeat 203..229 CDD:293788
armadillo repeat 238..270 CDD:293788
ARM 238..270 CDD:214547
armadillo repeat 278..314 CDD:293788
armadillo repeat 322..355 CDD:293788
PLN03200 <345..>675 CDD:215629 27/156 (17%)
ARM 358..398 CDD:214547
armadillo repeat 362..397 CDD:293788
armadillo repeat 410..435 CDD:293788
armadillo repeat 443..481 CDD:293788
armadillo repeat 487..525 CDD:293788
armadillo repeat 532..589 CDD:293788 10/52 (19%)
armadillo repeat 594..628 CDD:293788 6/33 (18%)
armadillo repeat 635..669 CDD:293788 7/51 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.