DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uck and Uprt

DIOPT Version :9

Sequence 1:NP_001138105.1 Gene:Uck / 42894 FlyBaseID:FBgn0263398 Length:305 Species:Drosophila melanogaster
Sequence 2:XP_228538.3 Gene:Uprt / 317237 RGDID:1564806 Length:309 Species:Rattus norvegicus


Alignment Length:298 Identity:53/298 - (17%)
Similarity:102/298 - (34%) Gaps:108/298 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LRLPNGDGAAANDEVKSPFLIGVAGGTASGKSTVCKKIMEQLGQAEMDHTQRQVVSISQDSFYRE 74
            |...|...::.:...::|     .|.:..|...:..:|..||....|:...|::.:|.:|.    
  Rat    74 LHCENHSDSSDSGNYEAP-----VGDSLLGDCELYPQIGAQLKLLPMNDQIRELQTIIRDK---- 129

  Fly    75 LTPAEKAKAQKGLFNFDHPDAFNEELMYSTLQNILKGHKVEIPSYDYRTNSLDFENVLVIYPA-- 137
                   .|.:|.|.|.     .:.|:...::..|              |.|.::..:|..|.  
  Rat   130 -------TASRGDFMFS-----ADRLIRLVVEEGL--------------NQLPYKECMVTTPTGH 168

  Fly   138 --DVVLFE----GILVFYFPK---------IRELFHMKLFVDTDSDTRLAR----RVPRDINERG 183
              :.|.||    |:.:....:         .|.:...|:.:.:|.:|:.|:    :.|.||:.| 
  Rat   169 KYEGVKFEKGNCGVSIMRSGEAMEQGLRDCCRSIRIGKILIQSDEETQRAKVYYAKFPPDIHRR- 232

  Fly   184 RDLDAVLTQYMTFVKPAFEEFCSPTKKFADVIIPRGADNTV--AIDLIVQHIRDFLNNRSRHGST 246
                .||..|                    .|:..|  |||  |:.::::           ||..
  Rat   233 ----KVLLMY--------------------PILSTG--NTVIEAVKVLIE-----------HGVQ 260

  Fly   247 GNMALYMNLDLNATGAGFAGPDGSNLGTYNAIRRFSTI 284
            .::.:.::|        |:.|.|:.    :.|:.|..|
  Rat   261 PSVIILLSL--------FSTPHGAK----SIIQEFPEI 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UckNP_001138105.1 UMPK 29..235 CDD:238981 41/228 (18%)
UprtXP_228538.3 UPRTase 118..308 CDD:291353 44/249 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D929897at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100147
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.