DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uck and arm

DIOPT Version :10

Sequence 1:NP_001138105.1 Gene:Uck / 42894 FlyBaseID:FBgn0263398 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_476665.2 Gene:arm / 31151 FlyBaseID:FBgn0000117 Length:843 Species:Drosophila melanogaster


Alignment Length:99 Identity:28/99 - (28%)
Similarity:39/99 - (39%) Gaps:25/99 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 CSPTKKFADVIIPRGADNTVAIDL------IVQHIRDFLNNRSRHGS--TGNMALYMNL------ 255
            ||..|   ..|:..|....:|:.|      :||:....|.|.|...:  .|..||..:|      
  Fly   358 CSSNK---PAIVDAGGMQALAMHLGNMSPRLVQNCLWTLRNLSDAATKVEGLEALLQSLVQVLGS 419

  Fly   256 -DLNAT--GAGFAGPDGSNLGTYNAIRRFSTICK 286
             |:|..  .||..    ||| |.|..|..:|:|:
  Fly   420 TDVNVVTCAAGIL----SNL-TCNNQRNKATVCQ 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UckNP_001138105.1 UMPK 29..235 CDD:238981 9/35 (26%)
armNP_476665.2 CTNNAbd_dArm 85..159 CDD:439243
Adaptin_N <150..>314 CDD:396262
armadillo repeat 161..186 CDD:293788
armadillo repeat 193..231 CDD:293788
armadillo repeat 238..270 CDD:293788
armadillo repeat 278..314 CDD:293788
armadillo repeat 320..355 CDD:293788
Arm 361..398 CDD:425727 9/39 (23%)
armadillo repeat 362..397 CDD:293788 9/37 (24%)
armadillo repeat 410..435 CDD:293788 6/28 (21%)
Arm 439..481 CDD:425727 3/10 (30%)
armadillo repeat 443..481 CDD:293788 2/6 (33%)
armadillo repeat 490..525 CDD:293788
Arm 597..636 CDD:425727
armadillo repeat 600..636 CDD:293788
armadillo repeat 641..675 CDD:293788
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.