DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uck and Uck2

DIOPT Version :9

Sequence 1:NP_001138105.1 Gene:Uck / 42894 FlyBaseID:FBgn0263398 Length:305 Species:Drosophila melanogaster
Sequence 2:XP_038946718.1 Gene:Uck2 / 304944 RGDID:620742 Length:267 Species:Rattus norvegicus


Alignment Length:230 Identity:143/230 - (62%)
Similarity:178/230 - (77%) Gaps:7/230 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PFLIGVA-GGTASGKSTVCKKIMEQLGQAEMDHTQRQVVSISQDSFYRELTPAEKAKAQKGLFNF 90
            |..:|.| |....|.|:||.||::.|||.|:|:.|:|||.:|||||||.||..:||||.||.|||
  Rat    25 PRKLGAACGRWRGGMSSVCAKIVQLLGQNEVDYHQKQVVILSQDSFYRVLTSEQKAKALKGQFNF 89

  Fly    91 DHPDAFNEELMYSTLQNILKGHKVEIPSYDYRTNSLDFENVLVIYPADVVLFEGILVFYFPKIRE 155
            ||||||:.||::.||:.|.:|..|:||.||:.::|.. |..:.|||||||||||||.||..::|:
  Rat    90 DHPDAFDNELIFKTLKEITEGKTVQIPVYDFVSHSRK-EETVTIYPADVVLFEGILAFYSQEVRD 153

  Fly   156 LFHMKLFVDTDSDTRLARRVPRDINERGRDLDAVLTQYMTFVKPAFEEFCSPTKKFADVIIPRGA 220
            ||.||||||||:||||:|||.|||:||||||:.:|:||:|||||||||||.||||:|||||||||
  Rat   154 LFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGA 218

  Fly   221 DNTVAIDLIVQHIRDFLN-NRSRHGSTGNMALYMN 254
            ||.|||:||||||:|.|| ..|:..:.|    |:|
  Rat   219 DNLVAINLIVQHIQDILNGGLSKRQTNG----YLN 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UckNP_001138105.1 UMPK 29..235 CDD:238981 135/206 (66%)
Uck2XP_038946718.1 UMPK 38..234 CDD:238981 132/196 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339524
Domainoid 1 1.000 271 1.000 Domainoid score I1744
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40850
Inparanoid 1 1.050 292 1.000 Inparanoid score I2687
OMA 1 1.010 - - QHG61683
OrthoDB 1 1.010 - - D509086at33208
OrthoFinder 1 1.000 - - FOG0002695
OrthoInspector 1 1.000 - - otm45166
orthoMCL 1 0.900 - - OOG6_100147
Panther 1 1.100 - - O PTHR10285
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2455
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.810

Return to query results.
Submit another query.