| Sequence 1: | NP_001138105.1 | Gene: | Uck / 42894 | FlyBaseID: | FBgn0263398 | Length: | 305 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_005157888.1 | Gene: | ctnnb1 / 30265 | ZFINID: | ZDB-GENE-980526-362 | Length: | 789 | Species: | Danio rerio |
| Alignment Length: | 252 | Identity: | 51/252 - (20%) |
|---|---|---|---|
| Similarity: | 89/252 - (35%) | Gaps: | 68/252 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 46 KIMEQLGQAEMDHTQRQVVSISQDSFYRELTPAEKAKAQKGLFNFDHPDAFNE------------ 98
Fly 99 -ELMYSTLQNILK---GHKVEIPSYDYRTNSLDFENVLVIYPADVVLFEGILVFYFPKIRELFHM 159
Fly 160 K-----------LFVDTDSDTRLARRVPRDINERGRDLDAVLTQYMTFVKPAFEEFCSPTKKFAD 213
Fly 214 VIIPRGADNTVAIDLIVQHIRDFLNNRSRH-GSTGNMALYMNLDLNATGAG-FAGPD 268 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Uck | NP_001138105.1 | UMPK | 29..235 | CDD:238981 | 38/215 (18%) |
| ctnnb1 | XP_005157888.1 | ARM | <151..221 | CDD:237987 | |
| armadillo repeat | 152..177 | CDD:293788 | |||
| armadillo repeat | 187..220 | CDD:293788 | |||
| ARM | 228..347 | CDD:237987 | |||
| armadillo repeat | 229..261 | CDD:293788 | |||
| armadillo repeat | 269..305 | CDD:293788 | |||
| armadillo repeat | 311..346 | CDD:293788 | |||
| ARM | 349..389 | CDD:214547 | |||
| armadillo repeat | 353..389 | CDD:293788 | |||
| ARM | 407..526 | CDD:237987 | |||
| armadillo repeat | 410..435 | CDD:293788 | |||
| armadillo repeat | 443..481 | CDD:293788 | |||
| armadillo repeat | 490..525 | CDD:293788 | |||
| ARM | 492..631 | CDD:237987 | 17/95 (18%) | ||
| armadillo repeat | 532..590 | CDD:293788 | 8/46 (17%) | ||
| armadillo repeat | 595..629 | CDD:293788 | 6/33 (18%) | ||
| ARM | 597..>676 | CDD:237987 | 18/103 (17%) | ||
| armadillo repeat | 637..670 | CDD:293788 | 7/43 (16%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0572 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||