DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uck and NMRK2

DIOPT Version :9

Sequence 1:NP_001138105.1 Gene:Uck / 42894 FlyBaseID:FBgn0263398 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001276046.1 Gene:NMRK2 / 27231 HGNCID:17871 Length:235 Species:Homo sapiens


Alignment Length:160 Identity:31/160 - (19%)
Similarity:64/160 - (40%) Gaps:33/160 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LIGVAGGTASGKSTVCKKIMEQLGQAEMDHTQRQVVSISQDSFYRE--LTPAEK-AKAQKGLFNF 90
            ::|:.|.|..||:|:...::..|....:.|         ||.|::.  ..|.:: |..:.|...:
Human     4 IVGIGGMTNGGKTTLTNSLLRALPNCCVIH---------QDDFFKAPLFQPQDQIAVGEDGFKQW 59

  Fly    91 DHPDAFNEELMYSTL-------QNILKGHKVEIPSYDYRTNSLDFENVLVIYPADVVLFEGILVF 148
            |..::.:.|.|..|:       |...:.|.|.:......|:              ::|.||.|::
Human    60 DVLESLDMEAMLDTVQAWLSSPQKFARAHGVSVQPEASDTH--------------ILLLEGFLLY 110

  Fly   149 YFPKIRELFHMKLFVDTDSDTRLARRVPRD 178
            .:..:.:|:..:.|:....:....||..|:
Human   111 SYKPLVDLYSRRYFLTVPYEECKWRRSTRN 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UckNP_001138105.1 UMPK 29..235 CDD:238981 31/160 (19%)
NMRK2NP_001276046.1 NRK1 4..169 CDD:238982 31/160 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.