DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uck and SPAC1399.04c

DIOPT Version :9

Sequence 1:NP_001138105.1 Gene:Uck / 42894 FlyBaseID:FBgn0263398 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_593510.1 Gene:SPAC1399.04c / 2542614 PomBaseID:SPAC1399.04c Length:220 Species:Schizosaccharomyces pombe


Alignment Length:90 Identity:18/90 - (20%)
Similarity:34/90 - (37%) Gaps:23/90 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 PTKKFADVIIPRGADNTVAIDLIVQHIRDFLNNRSRHGSTGNMALYMNLD-----------LNAT 260
            |.::..:|::.|   .|:.:..::..:||.....|....|.|:.:.|.:.           |..|
pombe     4 PLEQPENVVVLR---QTMYLLSLMTILRDQQTGHSEFVRTANLIINMLMQEALSALPYKKCLIKT 65

  Fly   261 GAGFAGPDGSNLGTYNAIRRFSTIC 285
            .:|         |||..::....||
pombe    66 SSG---------GTYTGVQPARDIC 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UckNP_001138105.1 UMPK 29..235 CDD:238981 4/27 (15%)
SPAC1399.04cNP_593510.1 UPRTase 16..219 CDD:291353 15/75 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100147
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.