DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uck and tad2

DIOPT Version :9

Sequence 1:NP_001138105.1 Gene:Uck / 42894 FlyBaseID:FBgn0263398 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_596505.2 Gene:tad2 / 2539634 PomBaseID:SPBC16D10.10 Length:389 Species:Schizosaccharomyces pombe


Alignment Length:305 Identity:80/305 - (26%)
Similarity:135/305 - (44%) Gaps:67/305 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ANDEVKSPFLIGVAGGTASGKSTVCKKIMEQLGQAEMDHTQRQVVSISQDSFYRELTPAEKAKAQ 84
            |.|.|||. :||:|||..|||:.:|::::|:|             ..|..|.:.:|.        
pombe     2 AGDSVKSA-IIGIAGGPFSGKTQLCEQLLERL-------------KSSAPSTFSKLI-------- 44

  Fly    85 KGLFNFDHPD--------AFNEELMYSTLQNILKG-HKVEIPSYDYRTNSLDFENVLVIYPAD-- 138
             .|.:|.:|:        :::.|.....|..|.:| .|:.:|           :...:..|.|  
pombe    45 -HLTSFLYPNSVDRYALSSYDIEAFKKVLSLISQGAEKICLP-----------DGSCIKLPVDQN 97

  Fly   139 -VVLFEGILVFYFPKIRELFHMKLFVDTDSDTRLARRVPRDINERGRDLDAVLTQYMTFVKPAFE 202
             ::|.||..:. .|::...:..|:||..|:||||.|.|.:.:.....||..||..::|..|||::
pombe    98 RIILIEGYYLL-LPELLPYYTSKIFVYEDADTRLERCVLQRVKAEKGDLTKVLNDFVTLSKPAYD 161

  Fly   203 EFCSPTKKFADVIIPRGADNTVAIDLIVQHIRDFLNNRSRHGSTGNM------ALYMNLDLNATG 261
            ....||::.||:|:|:..:...|:..:.||::|.|...::..|:..:      ..||.|      
pombe   162 SSIHPTRENADIILPQKENIDTALLFVSQHLQDILAEMNKTSSSNTVKYDTQHETYMKL------ 220

  Fly   262 AGFAGPDGSNLGTYNAIR-RFSTICKEL---NMQGNYFFETNKNL 302
                ..:..|||.|..|: |....|..:   .:.|..|.|||.:|
pombe   221 ----AHEILNLGPYFVIQPRSPGSCVFVYKGEVIGRGFNETNCSL 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UckNP_001138105.1 UMPK 29..235 CDD:238981 56/217 (26%)
tad2NP_596505.2 Udk 1..212 CDD:223645 64/244 (26%)
NK 10..195 CDD:302627 56/218 (26%)
TadA 212..360 CDD:223663 16/60 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1810
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.