DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uck and SPCC162.11c

DIOPT Version :9

Sequence 1:NP_001138105.1 Gene:Uck / 42894 FlyBaseID:FBgn0263398 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001342737.1 Gene:SPCC162.11c / 2538946 PomBaseID:SPCC162.11c Length:454 Species:Schizosaccharomyces pombe


Alignment Length:228 Identity:89/228 - (39%)
Similarity:137/228 - (60%) Gaps:14/228 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 AANDEVKSPF----LIGVAGGTASGKSTVCKKIMEQLGQAEMDHTQRQVVSISQDSFYRELTPAE 79
            ::|...:.|:    .||:||.:.|||::|.:.|::.|   .:.|    ||.:|.||||:.|...:
pombe     9 SSNPTYEPPWRKVRFIGIAGPSGSGKTSVAQLIVKAL---NLPH----VVILSLDSFYKSLNAEQ 66

  Fly    80 KAKAQKGLFNFDHPDAFNEELMYSTLQNILKGHKVEIPSYDYRT-NSLDFENVLVIYPADVVLFE 143
            |.:|....::||.|:|.:.:|::..|..:.:|.||:||.|.:.. |.|...|.|  :.|.:::.|
pombe    67 KKRAFNNDYDFDSPEAIDWDLLFVKLLELKQGRKVDIPIYSFNEHNRLPETNTL--FGASIIILE 129

  Fly   144 GILVFYFPKIRELFHMKLFVDTDSDTRLARRVPRDINERGRDLDAVLTQYMTFVKPAFEEFCSPT 208
            ||...|..|||.|..:.:|:|||||..|:||:.||||.||||:..||.||..||||::|.|....
pombe   130 GIFALYDEKIRSLLDVSVFLDTDSDVCLSRRLNRDINYRGRDIVGVLEQYNKFVKPSYENFVRRQ 194

  Fly   209 KKFADVIIPRGADNTVAIDLIVQHIRDFLNNRS 241
            ..:.|:|:|||.||.:|||:::..||..|:.:|
pombe   195 LSYTDLIVPRGRDNKLAIDMVINFIRRTLSIQS 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UckNP_001138105.1 UMPK 29..235 CDD:238981 84/206 (41%)
SPCC162.11cNP_001342737.1 UMPK 23..220 CDD:238981 83/205 (40%)
Upp 250..454 CDD:223113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100147
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1606
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.