DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uck and nmrk-1

DIOPT Version :9

Sequence 1:NP_001138105.1 Gene:Uck / 42894 FlyBaseID:FBgn0263398 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_491763.1 Gene:nmrk-1 / 188966 WormBaseID:WBGene00020842 Length:340 Species:Caenorhabditis elegans


Alignment Length:318 Identity:69/318 - (21%)
Similarity:110/318 - (34%) Gaps:114/318 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 FLIGVAGGTASGKSTVCKKIMEQLGQAEMDHTQRQVVSISQDSFYRELTPAEKA-------KAQK 85
            :::.:||.|.|||||:.|:.....|..|       ...|:||.||:.....||.       ...:
 Worm     7 YVLALAGCTNSGKSTLAKEFQRFFGAGE-------TTIINQDEFYKTENEVEKIYHPDAEHLTDE 64

  Fly    86 GLF-NFDHPDAFNEELMYSTLQNILKGHKVEIPSYDYRTNSLDFENVLVIYPADVVLFEGILVFY 149
            |.: :||..:|.|.:   ...|.||...||             ::||::         :|.::..
 Worm    65 GYYWSFDEKEAINID---QFRQRILNESKV-------------YKNVII---------DGNMITE 104

  Fly   150 FPKIRELFHMKLFVDTDSDTRLARR------VPRD-----IN----------ERGRDLDAVLTQY 193
            ..:|.:|....:.:..|..|...||      ||.|     :|          ||.|......:: 
 Worm   105 MDEIVDLCDRIVVMTLDFKTCKRRREARTDYVPADTPGYFVNVAFPAYVRHLERARQRSRTDSR- 168

  Fly   194 MTFVKPAFEEFCSPTK--------------KFADVIIPRGADNTVAIDLIVQH-----IRDFLN- 238
            :||:..:..:|....|              |..|.:|     :...:|.:|.|     |..|.. 
 Worm   169 LTFIDVSESKFDDKNKSIVNFRQQILDDHIKLTDEVI-----DVKVVDQLVSHPSCGAISTFNGV 228

  Fly   239 NRSRHGSTGNMALYMNLDLNATGAGFAGPDGSNLGTYN-----AIRRFSTICKELNMQ 291
            .|..||                     |.|.||| :|:     |.::...||.|:..:
 Worm   229 TRDNHG---------------------GRDVSNL-SYDCHDLMAYKKLRGICAEIRAE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UckNP_001138105.1 UMPK 29..235 CDD:238981 55/253 (22%)
nmrk-1NP_491763.1 NRK1 8..163 CDD:238982 44/186 (24%)
MoaE 205..332 CDD:238385 19/87 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.