DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uck and bar-1

DIOPT Version :9

Sequence 1:NP_001138105.1 Gene:Uck / 42894 FlyBaseID:FBgn0263398 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_509206.1 Gene:bar-1 / 180982 WormBaseID:WBGene00000238 Length:811 Species:Caenorhabditis elegans


Alignment Length:201 Identity:40/201 - (19%)
Similarity:70/201 - (34%) Gaps:41/201 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RNADTLRLPNG---DGAAANDEVKSPFLIGVAGGTASGKS-TVCKKIMEQLGQAEMDHTQRQVVS 65
            ||. |:||.:.   ....||:.....|:.|..|.....:: |:..|.|..|...|....:..:.|
 Worm   391 RNT-TIRLYSAQIMSNLVANNRHNKEFMCGNNGVVILVRALTIATKEMGDLRDKEAQQMEDYIES 454

  Fly    66 ISQDSFYRELTPAEKAKAQKGLFNFDHPDAFNEELM----------YSTLQNILKGHKVEIPSYD 120
            :.  ...|.|........:...|.|..|..|..:|:          .|.|..::..|.:..|...
 Worm   455 LI--CTLRHLCVGHPMSDKVQAFVFRDPALFLHKLLTMRPVLLKHTLSLLLKVVSQHALLAPFRS 517

  Fly   121 YRTNSLDFENVL--VIYPADVVL-----FEGILVFYFPKIRELFHMKLFVDTDSDTRLARRVPRD 178
            .|.....|...|  ::..|...|     .||:      :::::.|:.:        ::.|.:.||
 Worm   518 CRIGDKGFVEQLIHILRVACTQLNVQESIEGV------RVKDIIHLCI--------QILRWITRD 568

  Fly   179 ---INE 181
               :||
 Worm   569 QDILNE 574

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UckNP_001138105.1 UMPK 29..235 CDD:238981 32/174 (18%)
bar-1NP_509206.1 armadillo repeat 120..145 CDD:293788
armadillo repeat 155..195 CDD:293788
armadillo repeat 201..240 CDD:293788
armadillo repeat 294..331 CDD:293788
ARM 296..408 CDD:237987 5/17 (29%)
armadillo repeat 337..368 CDD:293788
Extensin_2 739..796 CDD:252669
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.