DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uck and F19B6.1

DIOPT Version :9

Sequence 1:NP_001138105.1 Gene:Uck / 42894 FlyBaseID:FBgn0263398 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001368094.1 Gene:F19B6.1 / 178181 WormBaseID:WBGene00008948 Length:569 Species:Caenorhabditis elegans


Alignment Length:229 Identity:110/229 - (48%)
Similarity:156/229 - (68%) Gaps:17/229 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VKSPFLIGVAGGTASGKSTVCKKIMEQLGQAEMDHTQRQVVSISQDSFYRELTPAEKAKAQKGLF 88
            :|.||:|||.||:||||:||.:||:|:||..       .|..:|.||||:.|||.|...|.:..:
 Worm   115 LKHPFVIGVCGGSASGKTTVAEKIVERLGIP-------WVTILSMDSFYKVLTPEEIKAAHESRY 172

  Fly    89 NFDHPDAFNEELMYSTLQNILKGHKVEIPSYDYRTNSLDFENVLVIYPADVVLFEGILVFYFPKI 153
            |||.|:||:.:|:|..|:.:.:|..|::|.||:.|:|.| .|..::|.|||::|||||.|:..:|
 Worm   173 NFDGPNAFDFDLLYEVLKRLREGKSVDVPVYDFNTHSRD-PNSKMMYGADVLIFEGILAFHDERI 236

  Fly   154 RELFHMKLFVDTDSDTRLARRVPRDINERGRDLDAVLTQYMTFVKPAFEEFCSPTKKFADVIIPR 218
            :.|..||:|||||.|.|||||:.||:.:||||:|.::.||.|||||||:::.:|....||:|:||
 Worm   237 KNLMDMKVFVDTDGDLRLARRIVRDVTDRGRDIDGIMEQYFTFVKPAFDKYIAPCMDSADLIVPR 301

  Fly   219 GADNTVAIDLIVQHIRDFL---------NNRSRH 243
            |.:|.||||:|||::...|         |||.||
 Worm   302 GGENDVAIDMIVQNVMAQLVERGYDRNQNNRDRH 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UckNP_001138105.1 UMPK 29..235 CDD:238981 101/205 (49%)
F19B6.1NP_001368094.1 UMPK 120..319 CDD:238981 101/206 (49%)
UPRTase 355..557 CDD:405383
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D509086at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100147
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1606
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.