DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uck and Jup

DIOPT Version :9

Sequence 1:NP_001138105.1 Gene:Uck / 42894 FlyBaseID:FBgn0263398 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_034723.1 Gene:Jup / 16480 MGIID:96650 Length:745 Species:Mus musculus


Alignment Length:106 Identity:21/106 - (19%)
Similarity:44/106 - (41%) Gaps:17/106 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 KSTVCKKIMEQLGQAEMDHTQRQVVSISQDSFYRELTPAEKAKAQKGLFNFDHPDAFNE------ 98
            ::.|..::::.|.:|..| .||.|.:.:|..:...:...|..:...|..:....|..|.      
Mouse   520 EAAVIPRLVQLLVKAHQD-AQRHVAAGTQQPYTDGVRMEEIVEGCTGALHILARDPMNRMEIFRL 583

  Fly    99 -------ELMYSTLQNILK---GHKVEIPSYDYRTNSLDFE 129
                   :|:||:::||.:   |...|:.......:::|.|
Mouse   584 NTIPLFVQLLYSSVENIQRVAAGVLCELAQDKEAADAIDAE 624

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UckNP_001138105.1 UMPK 29..235 CDD:238981 21/106 (20%)
JupNP_034723.1 ARM 6 342..381
armadillo repeat 345..380 CDD:293788
ARM 7 383..420
armadillo repeat 393..418 CDD:293788
ARM 8 423..464
armadillo repeat 426..464 CDD:293788
ARM 9 470..510
armadillo repeat 470..508 CDD:293788
ARM 10 512..551 8/31 (26%)
armadillo repeat 515..572 CDD:293788 10/52 (19%)
Interaction with DSC1. /evidence=ECO:0000250 574..661 10/51 (20%)
armadillo repeat 577..611 CDD:293788 6/33 (18%)
armadillo repeat 618..652 CDD:293788 2/7 (29%)
Adaptin_N <120..>289 CDD:366724
Interaction with DSC1 and DSG1. /evidence=ECO:0000250 132..297
armadillo repeat 144..169 CDD:293788
armadillo repeat 186..212 CDD:293788
armadillo repeat 221..253 CDD:293788
ARM 221..253 CDD:214547
armadillo repeat 261..297 CDD:293788
ARM 5 298..341
armadillo repeat 305..338 CDD:293788
PLN03200 <328..>658 CDD:215629 21/106 (20%)
ARM 341..381 CDD:214547
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.