DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uck and Atcay

DIOPT Version :10

Sequence 1:NP_001138105.1 Gene:Uck / 42894 FlyBaseID:FBgn0263398 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_848777.1 Gene:Atcay / 16467 MGIID:2448730 Length:372 Species:Mus musculus


Alignment Length:143 Identity:28/143 - (19%)
Similarity:41/143 - (28%) Gaps:63/143 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 TLRLPNGD-----------------------GAAANDEVKSPFLIGVAGGTASGKSTVCKKIMEQ 50
            |||:.|.|                       |.|..|....|..:.::|.....|:.|..:|...
Mouse     7 TLRMENVDVRDEWQDEDLPRPLPEDTGVERLGGAVEDSSSPPSTLNLSGAHRKRKTLVAPEINIS 71

  Fly    51 LGQAEMDHTQRQVVSISQDSFYRELTPAEKAKAQKGLFNFDHPDAFNEELMYSTLQNILKGHKVE 115
            |.|:|        .|:..|.|                  .|.||..:           :....:|
Mouse    72 LDQSE--------GSLLSDDF------------------LDTPDDLD-----------INVDDIE 99

  Fly   116 IPSYDYRTNSLDF 128
            .|.   .|:||:|
Mouse   100 TPD---ETDSLEF 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UckNP_001138105.1 UMPK 29..235 CDD:238981 19/100 (19%)
AtcayNP_848777.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..58 10/50 (20%)
BNIP2 59..187 CDD:463609 18/91 (20%)
Required for interaction with KLC1. /evidence=ECO:0000269|PubMed:19861499 115..120
CRAL_TRIO_2 189..325 CDD:463965
Mediates interaction with GLS. /evidence=ECO:0000250 190..372
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 329..372
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.