DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uck and CTNNB1

DIOPT Version :9

Sequence 1:NP_001138105.1 Gene:Uck / 42894 FlyBaseID:FBgn0263398 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001091679.1 Gene:CTNNB1 / 1499 HGNCID:2514 Length:781 Species:Homo sapiens


Alignment Length:238 Identity:50/238 - (21%)
Similarity:86/238 - (36%) Gaps:69/238 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 KIMEQLGQAEMDHTQRQVVSISQDSFYRELTPAEKAKAQKGLFNFDHPDAFNE------------ 98
            ::::.|.:|..|..:|..:..:|..|...:...|..:...|..:....|..|.            
Human   535 RLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLF 599

  Fly    99 -ELMYSTLQNILK---GHKVEIPSYDYRTNSLDFENVLVIYPADVVLFEGILVFYFPKIRELFHM 159
             :|:||.::||.:   |...|:        :.|.|      .|:.:..||...    .:.||.|.
Human   600 VQLLYSPIENIQRVAAGVLCEL--------AQDKE------AAEAIEAEGATA----PLTELLHS 646

  Fly   160 K-----------LFVDTDSDTRLARRVPRDINERGRDLDAVLTQYMTFVKP-AFEEFCSPTKKFA 212
            :           ||       |::...|:|..:|   |...||..:...:| |:.|       .|
Human   647 RNEGVATYAAAVLF-------RMSEDKPQDYKKR---LSVELTSSLFRTEPMAWNE-------TA 694

  Fly   213 DVIIPRGADNTVAIDLIVQHIRDFLNNRSRH-GSTGNMALYMN 254
            |:.:..||....     :.:.:|..:.||.| |..|..||.|:
Human   695 DLGLDIGAQGEP-----LGYRQDDPSYRSFHSGGYGQDALGMD 732

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UckNP_001138105.1 UMPK 29..235 CDD:238981 41/216 (19%)
CTNNB1NP_001091679.1 Interaction with VCL. /evidence=ECO:0000250 2..23
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..57
SRP1 142..>431 CDD:227396
ARM 1 151..191
armadillo repeat 153..178 CDD:293788
Interaction with BCL9. /evidence=ECO:0000269|PubMed:17052462 156..178
armadillo repeat 188..221 CDD:293788
ARM 2 193..234
armadillo repeat 230..262 CDD:293788
ARM 230..262 CDD:214547
ARM 3 235..276
armadillo repeat 270..306 CDD:293788
ARM 4 277..318
armadillo repeat 312..347 CDD:293788
ARM 5 319..360
ARM 350..390 CDD:214547
armadillo repeat 354..389 CDD:293788
ARM 6 361..389
ARM 7 400..441
armadillo repeat 402..427 CDD:293788
Arm 431..473 CDD:395413
armadillo repeat 435..473 CDD:293788
ARM 8 442..484
armadillo repeat 482..517 CDD:293788
ARM 9 489..530
armadillo repeat 524..582 CDD:293788 8/46 (17%)
ARM 10 531..571 7/35 (20%)
Arm 583..622 CDD:395413 9/46 (20%)
armadillo repeat 587..621 CDD:293788 6/33 (18%)
ARM 11 594..636 11/55 (20%)
armadillo repeat 629..662 CDD:293788 7/43 (16%)
ARM 12 637..666 6/39 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 705..781 9/33 (27%)
Interaction with SCRIB. /evidence=ECO:0000250 772..781
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.