DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uck and UPRT

DIOPT Version :9

Sequence 1:NP_001138105.1 Gene:Uck / 42894 FlyBaseID:FBgn0263398 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_659489.1 Gene:UPRT / 139596 HGNCID:28334 Length:309 Species:Homo sapiens


Alignment Length:306 Identity:55/306 - (17%)
Similarity:102/306 - (33%) Gaps:128/306 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GAAANDEVKSPFLIGVAGGTASGKST---------------VCKKIMEQLGQAEMDHTQRQVVSI 66
            |::.|.|          |.:.||.|:               :.::|..||....|:...|::.:|
Human    71 GSSLNSE----------GNSGSGDSSSYDAPAGNSFLEDCELSRQIGAQLKLLPMNDQIRELQTI 125

  Fly    67 SQDSFYRELTPAEKAKAQKGLFNFDHPDAFNEELMYSTLQNILKGHKVEIPSYDYRTNSLDFENV 131
            .:|.           .|.:|.|.|.     .:.|:...::..|              |.|.::..
Human   126 IRDK-----------TASRGDFMFS-----ADRLIRLVVEEGL--------------NQLPYKEC 160

  Fly   132 LVIYPA----DVVLFE----GILVFYFPK---------IRELFHMKLFVDTDSDTRLAR----RV 175
            :|..|.    :.|.||    |:.:....:         .|.:...|:.:.:|.:|:.|:    :.
Human   161 MVTTPTGYKYEGVKFEKGNCGVSIMRSGEAMEQGLRDCCRSIRIGKILIQSDEETQRAKVYYAKF 225

  Fly   176 PRDINERGRDLDAVLTQYMTFVKPAFEEFCSPTKKFADVIIPRGADNTV--AIDLIVQHIRDFLN 238
            |.||..|     .||..|                    .|:..|  |||  |:.::::       
Human   226 PPDIYRR-----KVLLMY--------------------PILSTG--NTVIEAVKVLIE------- 256

  Fly   239 NRSRHGSTGNMALYMNLDLNATGAGFAGPDGSNLGTYNAIRRFSTI 284
                ||...::.:.::|        |:.|.|:.    :.|:.|..|
Human   257 ----HGVQPSVIILLSL--------FSTPHGAK----SIIQEFPEI 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UckNP_001138105.1 UMPK 29..235 CDD:238981 43/243 (18%)
UPRTNP_659489.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38
UPRTase 118..308 CDD:317125 44/249 (18%)
5-phospho-alpha-D-ribose 1-diphosphate binding. /evidence=ECO:0000250|UniProtKB:Q26998 238..246 3/29 (10%)
Uracil binding. /evidence=ECO:0000250|UniProtKB:Q26998 299..301
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D929897at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100147
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1606
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.