DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uck and uprt

DIOPT Version :9

Sequence 1:NP_001138105.1 Gene:Uck / 42894 FlyBaseID:FBgn0263398 Length:305 Species:Drosophila melanogaster
Sequence 2:XP_002931835.1 Gene:uprt / 100487820 XenbaseID:XB-GENE-998574 Length:257 Species:Xenopus tropicalis


Alignment Length:252 Identity:49/252 - (19%)
Similarity:84/252 - (33%) Gaps:90/252 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LRLPNGDGAA-----ANDEVKSPFLIGVAGGTASGKSTVCKKIMEQLGQAEMDHTQRQVVSISQD 69
            :|..:|.|::     .::|..||.|.|:       ......|..:|:|.        |:..:..:
 Frog    15 IRFADGSGSSNEGDKESEESGSPLLDGL-------PLQELPKDQQQVGP--------QLKLLPMN 64

  Fly    70 SFYREL-TPAEKAKAQKGLFNFDHPDAFNEELMYSTLQNILKGHKVEIPSYDYRTNSLDFENVLV 133
            ...||| |........:|.|.|.     .:.|:...::..|              |.|.:....|
 Frog    65 DQIRELQTIIRDRSTSRGDFVFS-----ADRLIRLVVEEGL--------------NQLPYTECTV 110

  Fly   134 IYPA----DVVLFE----GILVFYFPK---------IRELFHMKLFVDTDSDTRLAR----RVPR 177
            ..|.    |.|.||    |:.:....:         .|.:...|:.:.:|.:|:.|:    :.|.
 Frog   111 TTPTGYKYDGVKFEKGNCGVSIMRSGEAMEQGLRDCCRSIRIGKILIQSDEETQKAKVYYAKFPP 175

  Fly   178 DINERGRDLDAVLTQYMTFVKPAFEEFCSPTKKFADVIIPRGADNTV--AIDLIVQH 232
            ||..|     .||..|                    .|:..|  |||  |:.::::|
 Frog   176 DIYRR-----KVLLMY--------------------PILSTG--NTVIEAVKVLIEH 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UckNP_001138105.1 UMPK 29..235 CDD:238981 43/228 (19%)
uprtXP_002931835.1 UPRTase 66..256 CDD:373220 37/186 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D929897at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1606
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.040

Return to query results.
Submit another query.