powered by:
Protein Alignment CG6356 and pabir2
DIOPT Version :9
Sequence 1: | NP_651240.1 |
Gene: | CG6356 / 42893 |
FlyBaseID: | FBgn0039178 |
Length: | 570 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001017288.1 |
Gene: | pabir2 / 550042 |
XenbaseID: | XB-GENE-6455321 |
Length: | 280 |
Species: | Xenopus tropicalis |
Alignment Length: | 68 |
Identity: | 15/68 - (22%) |
Similarity: | 33/68 - (48%) |
Gaps: | 9/68 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 331 VAAPSQVASDKKSLEPEEGFSFGQKLKNGPLKSII----ELYANSKVRRMIFASYFMFC--VTSL 389
:.:|::..|.|:|..| .::.:....||:|..: |:...::.:|:...:..|.. ||.:
Frog 167 IPSPTRRFSTKRSRSP---VNYIRPSAFGPIKRKVLGEMEMEVENQPKRLFQGTTNMLSSDVTQM 228
Fly 390 SYY 392
||:
Frog 229 SYF 231
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG6356 | NP_651240.1 |
MFS |
167..544 |
CDD:119392 |
15/68 (22%) |
pabir2 | NP_001017288.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C165171886 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.