DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6356 and pabir2

DIOPT Version :9

Sequence 1:NP_651240.1 Gene:CG6356 / 42893 FlyBaseID:FBgn0039178 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_001017288.1 Gene:pabir2 / 550042 XenbaseID:XB-GENE-6455321 Length:280 Species:Xenopus tropicalis


Alignment Length:68 Identity:15/68 - (22%)
Similarity:33/68 - (48%) Gaps:9/68 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 VAAPSQVASDKKSLEPEEGFSFGQKLKNGPLKSII----ELYANSKVRRMIFASYFMFC--VTSL 389
            :.:|::..|.|:|..|   .::.:....||:|..:    |:...::.:|:...:..|..  ||.:
 Frog   167 IPSPTRRFSTKRSRSP---VNYIRPSAFGPIKRKVLGEMEMEVENQPKRLFQGTTNMLSSDVTQM 228

  Fly   390 SYY 392
            ||:
 Frog   229 SYF 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6356NP_651240.1 MFS 167..544 CDD:119392 15/68 (22%)
pabir2NP_001017288.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165171886
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.