DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6356 and T05A1.5

DIOPT Version :9

Sequence 1:NP_651240.1 Gene:CG6356 / 42893 FlyBaseID:FBgn0039178 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_001366751.1 Gene:T05A1.5 / 188077 WormBaseID:WBGene00011456 Length:359 Species:Caenorhabditis elegans


Alignment Length:270 Identity:65/270 - (24%)
Similarity:105/270 - (38%) Gaps:62/270 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 QDTNWTHAQKREIVAKG---LDSGGCTVWD-------------WNYGHLAKMSYEAALNYTGHLT 125
            |..|.|.:.|.|...|.   ||..|  :|.             |....:..||       ..::.
 Worm    53 QSPNMTSSIKVETSIKVEDLLDQIG--IWHPYPLFITFSMAFLWLLSVMPTMS-------PSYMA 108

  Fly   126 QISPPAEVSCR-VKGQHEFAHPETTFVADWDLTCDRSIQRTSAQVSISLGKFCGSFSF---GIL- 185
            ..||....:|. |..|:||                 :|.:|    .|..|:...|..|   ||| 
 Worm   109 PSSPCTLDNCSFVTVQNEF-----------------NITKT----LIDPGEMTSSIFFLGNGILG 152

  Fly   186 ------ADKFGRKSSFTLGAAFFIVG--SFFCTFSPWYSLFLAGRFALGAASSGLFYPAFTMIVE 242
                  ||:.||:.  .|.|:.||.|  .....::|.:.:.|.|||..|:..:.|....:.|..|
 Worm   153 QIYAVAADRIGRRP--VLIASLFISGLSGIGAAYAPTFEIMLIGRFFQGSCFTALTMINWVMCCE 215

  Fly   243 NICLKHRSWMSIAFSASYPVGMIILAIVGYVIQPWRHLQLALTIPSLLL-ILNCYLMSESPRWLI 306
            :|......:.|:.|...:.:|...::.:......||::|||.::|.:|. ||..:.:.||..:|:
 Worm   216 SISFSGHGYASVLFGLCWVIGYCSVSPLAMYFSTWRYVQLATSVPCVLFGILMMFTLPESFSFLV 280

  Fly   307 TNQRYDRVYK 316
            ..::.|.:.|
 Worm   281 AKRKRDDLVK 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6356NP_651240.1 MFS 167..544 CDD:119392 43/163 (26%)
T05A1.5NP_001366751.1 MFS 117..>271 CDD:421695 45/176 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163057
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D386678at33208
OrthoFinder 1 1.000 - - FOG0000012
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.