DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shps and CG7460

DIOPT Version :9

Sequence 1:NP_651239.1 Gene:shps / 42892 FlyBaseID:FBgn0286199 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_001261998.1 Gene:CG7460 / 39973 FlyBaseID:FBgn0036749 Length:486 Species:Drosophila melanogaster


Alignment Length:502 Identity:91/502 - (18%)
Similarity:178/502 - (35%) Gaps:153/502 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VLIVGGGLSGLASALKILAMESTLKVRMIEASDALGGLM------------------GQNSTRLV 60
            ::|||.|.:|:|:|.::|.: ....|.::||.|.:||.:                  |:....:.
  Fly    18 IVIVGAGSAGIAAATRLLDL-GFRNVLLLEAEDRIGGRVHTIPFADNVVDLGAQWCHGEKGNVVY 81

  Fly    61 DAAQQDMLALLTLIHLSP-RRRRS--------ISGSLRRCWDL---DRGLTAMPAKFELGRYIDM 113
            |..:...|..:|..|... |..||        ::..|:...|:   ||....:..:..||.||:|
  Fly    82 DKVKDLNLLEVTEPHYETFRCVRSNKEVLPDDLADQLKTIADMSIPDRQAELLDFEGSLGDYINM 146

  Fly   114 LDLRMPKFRSKRFNLRERVSNMEQHICHHLFFSKSRNFMLNLVQLVCGVPANEVDYDVFMSVCSS 178
                      |.:....::..:::.|        :..|:....:....|.|.:..::|     |.
  Fly   147 ----------KYWKELAKLPPIDRTI--------AEEFLEVFHKFEASVEAADHLFEV-----SG 188

  Fly   179 CGGLKVLI---DFYFTYPTSFYEISTQMLI---ENILEQLQFIK--IILNCRAVRLEHFKNYVQV 235
            .|.|:..:   :....:....|:...::|:   |:..|.|..:|  :.||.|...: ::|...::
  Fly   189 KGHLEYWLCEGELLLNWKDKGYKRFLKLLMKAPEDQSEDLGILKDHVRLNRRIAEI-NWKGADEL 252

  Fly   236 TDD--QGNKHTAQAAILAIPWNKVQKLHFEPRIPKVFLPRTTSRSGR--KGRQV--ISQF----- 289
            |..  .|...||...|..:....:::.|     ||:|:|...:...|  :|.::  :.:|     
  Fly   253 TVRCWNGEVITADHVICTVSLGVLKEQH-----PKLFVPALPAAKVRAIEGLKLGTVDKFFLEFE 312

  Fly   290 ---------------------QLRYGKSVWTDLGYSGNFLSSQP------MVSGHECRMSSFCGY 327
                                 :||..:..|.:..:....:|.||      ::..|...|.:.   
  Fly   313 NPPLPGDWPGFNCLWLKEDLEELRASELFWLESVFGFYPVSRQPRILQGWIIGPHARHMETL--- 374

  Fly   328 VLHLPEDQDEVLQDVVDLLAEHFGEEMRQPLEC------------------QCFTDELNVAQHKP 374
                  .::.||:.::.|..:....|...|:..                  ..:||.|       
  Fly   375 ------TEERVLEGLLWLFRKFLPFETAHPVRMLRTQWHANPNFRGSYTFRSTYTDAL------- 426

  Fly   375 QTKPWH------------RVIWSSSSAVGTSYRSLMGGAVQSGFRAA 409
            :|..|.            |:.::..|.....| |.:.|||::|:|.|
  Fly   427 RTGAWDLEAPLQDVCGRPRLQFAGESTHKHFY-STVHGAVETGWREA 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shpsNP_651239.1 NADB_Rossmann 11..>53 CDD:304358 14/56 (25%)
Amino_oxidase 21..409 CDD:279874 86/493 (17%)
CG7460NP_001261998.1 Amino_oxidase 32..476 CDD:279874 84/488 (17%)
NAD_binding_8 33..>74 CDD:290186 7/41 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452792
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.