DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Orct and CG5592

DIOPT Version :9

Sequence 1:NP_001262908.1 Gene:Orct / 42891 FlyBaseID:FBgn0019952 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_647996.1 Gene:CG5592 / 38662 FlyBaseID:FBgn0035645 Length:540 Species:Drosophila melanogaster


Alignment Length:529 Identity:144/529 - (27%)
Similarity:254/529 - (48%) Gaps:25/529 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 YDDVITHLGEFGPYQKRIYYLLCLPAIVCAFHKLAGVFLLAKPDFRCALPYENGSIYELSPHLWN 67
            |::.:..:|:|||:|||:.:.:...|.:.||.....:|::..|........|...:.|....  |
  Fly     9 YENFLLFIGDFGPFQKRLLFWMMPAAFLFAFTYFGQIFMILLPKNHWCRVRELEGLPESEQK--N 71

  Fly    68 LSYPEN-----ERCSYYDVDYTEEYLNGSIPRSSNETKT---CSS-YVYDRSKY-LNSAVTEWNL 122
            ...|:.     |.|..|:|.|.....|     .:|:|::   |:: ::|||.:. ..|..||:|.
  Fly    72 RGIPKKQDGSFENCFMYNVPYDSNATN-----DANQTRSPIPCNNGWIYDRKEVPYESIATEYNW 131

  Fly   123 VCSRSLLSATSDSLFMLGVLLGSLIFGQMSDKLGRKPTFFASLVLQLIFGVLAAVAPEYFSYTIS 187
            ||.:......|..::.:|.::|.|.||.::|..||.|..|.:....:|.|.::.|..::..:..|
  Fly   132 VCDKRDFGTYSVVVYFVGCIVGCLCFGFITDHSGRLPALFLANSCSMIGGCVSVVCKDFPCFAAS 196

  Fly   188 RMIVGATTSGVFLVAYVIALEMVGSSYRLFAG-VAMQMFFSVGFMLTAGFAYFIHDWRWLQIAIT 251
            |.:.|.:.:..|:..|::.||.||..||...| :|:..||::|..|....||.|.:||...:.:.
  Fly   197 RFVAGLSMNYCFVPIYILTLENVGIKYRTLVGNLALTFFFTLGACLLPWLAYVISNWRHYAMVVA 261

  Fly   252 LPGLLFLCYYWIIPESARWLLMKGRKDEAFVIIEKAAKENKVEVPNEIYEQLVDEVAEKKKQDEM 316
            ||.:..:....:.|||..||:..|:.|....::::|||.|...:..|::.:: .|..|.|..:|.
  Fly   262 LPIVFMILTSLLAPESPSWLMSVGKVDRCIEVMKEAAKANGKIISEEVWSEM-RECYELKFANEQ 325

  Fly   317 AASQPAATVFDLLR-YPNLRRKTLLIFFDWFVNSGVYYGLSWNTNNLGGNQLVNFMISGAVEIPG 380
            ...|  .|..||.: :|.|...|:|| ..|...:..|.........|..:..:.|.:|..||||.
  Fly   326 LGKQ--YTSLDLFKTFPRLVVLTILI-VTWMTVALAYDAHVRVVEILDTDIFITFSLSSLVEIPA 387

  Fly   381 YTLLLFTLNRWGRRSILCGTMMVAGISLLATIFVPSDMNWLIVACAMIGKLAITSSYGTIYIFSA 445
            ..:.:..|:|.||:.::...|::...|.|....:..  :|.....|:..:...|.:|.....:::
  Fly   388 GIVPMLLLDRIGRKPMMSAVMLLCAASSLFVGILKG--HWNASTAAIAARFFATMAYNVGQQWAS 450

  Fly   446 EQFPTVVRNVGLGASSMVARVGGILAPYLKLLGEIWRPLPLIICGALSLTAGLLSLLLPETLNKP 510
            |..|||:|..||...:::.::|.:|:|.:......:||||:.|...:|:...|:.|.||||....
  Fly   451 EILPTVLRGQGLAIINIMGQMGALLSPLVLSTHRYYRPLPMFIITLVSVIGALIILFLPETKGAT 515

  Fly   511 MPETIEDGE 519
            ||:|:::.|
  Fly   516 MPQTLDEAE 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OrctNP_001262908.1 2A0119 11..514 CDD:273328 141/514 (27%)
MFS 135..491 CDD:119392 97/357 (27%)
CG5592NP_647996.1 2A0119 17..519 CDD:273328 141/514 (27%)
MFS 141..509 CDD:119392 101/373 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458413
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9N9
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I1789
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000012
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X24
76.890

Return to query results.
Submit another query.