DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Orct and Sv2c

DIOPT Version :9

Sequence 1:NP_001262908.1 Gene:Orct / 42891 FlyBaseID:FBgn0019952 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_113781.1 Gene:Sv2c / 29643 RGDID:619718 Length:727 Species:Rattus norvegicus


Alignment Length:566 Identity:116/566 - (20%)
Similarity:201/566 - (35%) Gaps:192/566 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 LNSAVTEWNLVCSRSLLSATSDSLFMLGVLLGSLIFGQMSDKLGRKPTFFASLVLQLIFGVLAAV 177
            |.||.|:   :|..:..|....|:..||:::|:..:|.::||:|||.:....:.:...|..|::.
  Rat   176 LPSAETD---LCIPNSGSGWLGSIVYLGMMVGAFFWGGLADKVGRKQSLLICMSVNGFFAFLSSF 237

  Fly   178 APEYFSYTISRMI----VGATTSGVF-LVAYVIALE-------------MVGSSYRLFAGVAMQM 224
            ...|..:.:.|::    :|.....|| ..|.|:|.|             |:|..|.  :.:|..:
  Rat   238 VQGYGFFLLCRLLSGFGIGGAIPTVFSYFAEVLAREKRGEHLSWLCMFWMIGGIYA--SAMAWAI 300

  Fly   225 FFSVGFMLTAGFAYFIHDWRWLQIAITLPGLLFLCYYWIIPESARWLLMKGRKDEAFVII----- 284
            ....|:..:.|.||..|.||...|...||.:..:.....:|||.|:||..|:.|||::|:     
  Rat   301 IPHYGWSFSMGSAYQFHSWRVFVIVCALPCVSSVVALTFMPESPRFLLEVGKHDEAWMILKLIHD 365

  Fly   285 ---------EKAAKENKVEVPNEIYEQLVDEVAEKKK-------------QDEMAASQPAATVFD 327
                     ||....||::.|.:|     ||:.|.:.             :.|:....  .|...
  Rat   366 TNMRARGQPEKVFTVNKIKTPKQI-----DELIEIESDTGTWYRRCFVRIRTELYGIW--LTFMR 423

  Fly   328 LLRYPNLRRKTLLIFFDWFVNSGVYYGLS-W---------------NTNNLGGNQLVNFMISGAV 376
            ...|| :|..|:.:...||..|..||||| |               .|.|:..::..||.|:..:
  Rat   424 CFNYP-VRENTIKLTIVWFTLSFGYYGLSVWFPDVIKHLQSDEYALLTRNVQKDKYANFSINFTM 487

  Fly   377 E---------------------------------------------------------------- 377
            |                                                                
  Rat   488 ENQVHTGMEYDNGRFLGVKFKSVTFKDSVFKSCTFDDVTSVNTYFKNCTFIDTLFENTDFEPYKF 552

  Fly   378 -----------------------------------------IPGYTLLLFTLNRWGRRSILCGTM 401
                                                     :||..:....::|.||.::|.|:|
  Rat   553 IDSEFQNCSFLHNKTGCQITFDDDYSAYWIYFVNFLGTLAVLPGNIVSALLMDRIGRLTMLGGSM 617

  Fly   402 MVAGISLLATIFVPSDMNWLIVACAMIGKLAI-----TSSYGTIYIFSAEQFPTVVRNVGLGASS 461
            :::|||.....|..|:       ..|||.|.:     .|::.::.:.:.|.:||..|..|.|..:
  Rat   618 VLSGISCFFLWFGTSE-------SMMIGMLCLYNGLTISAWNSLDVVTVELYPTDRRATGFGFLN 675

  Fly   462 MVARVGGILAPYL-KLLGEIWRPLPLIICGALSLTAGLLSLLLPET 506
            .:.:...:|...: ..|..|.:.:|:::...:.:..||:.|.||:|
  Rat   676 ALCKAAAVLGNLIFGSLVSITKAIPILLASTVLVCGGLVGLRLPDT 721

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OrctNP_001262908.1 2A0119 11..514 CDD:273328 116/566 (20%)
MFS 135..491 CDD:119392 104/527 (20%)
Sv2cNP_113781.1 synapt_SV2 1..727 CDD:130366 116/566 (20%)
Interaction with SYT1. /evidence=ECO:0000269|PubMed:15866046 1..57
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..120
MFS 155..719 CDD:119392 113/562 (20%)
Pentapeptide_3 507..561 CDD:290309 0/53 (0%)
(Microbial infection) C.botulinum neurotoxin type A-binding. /evidence=ECO:0000269|PubMed:16543415, ECO:0000269|PubMed:27294781 529..566 0/36 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.